Serinus canaria (common canary): 103816985 Help Entry 103816985         CDS       T05755                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism scan  Serinus canaria (common canary) Pathway scan04144   Endocytosis scan04150   mTOR signaling pathway scan04270   Vascular smooth muscle contraction scan04310   Wnt signaling pathway scan04350   TGF-beta signaling pathway scan04510   Focal adhesion scan04520   Adherens junction scan04530   Tight junction scan04621   NOD-like receptor signaling pathway scan04625   C-type lectin receptor signaling pathway scan04810   Regulation of actin cytoskeleton scan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scan00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103816985 (RHOA)    04350 TGF-beta signaling pathway     103816985 (RHOA)    04150 mTOR signaling pathway     103816985 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103816985 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103816985 (RHOA)    04520 Adherens junction     103816985 (RHOA)    04530 Tight junction     103816985 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103816985 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103816985 (RHOA)    04625 C-type lectin receptor signaling pathway     103816985 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103816985 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103816985 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scan04131]     103816985 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:scan04147]     103816985 (RHOA)    04031 GTP-binding proteins [BR:scan04031]     103816985 (RHOA) Membrane trafficking [BR:scan04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103816985 (RHOA) Exosome [BR:scan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103816985 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103816985 (RHOA)   Exosomal proteins of colorectal cancer cells    103816985 (RHOA)   Exosomal proteins of bladder cancer cells    103816985 (RHOA) GTP-binding proteins [BR:scan04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103816985 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103816985 NCBI-ProteinID:  XP_030083726 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccactgtctttgaa aattacgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaggaagattacgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgatgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cctgaggaaggccgggatatggcaaaccgaattggtgcattcgggtacatggagtgttcg gcaaagaccaaagacggtgtcagggaggtgtttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system