Serinus canaria (common canary): 103817017 Help Entry 103817017         CDS       T05755                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism scan  Serinus canaria (common canary) Pathway scan04137   Mitophagy - animal scan04140   Autophagy - animal scan04144   Endocytosis scan04145   Phagosome scan04148   Efferocytosis scan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scan00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103817017 (RAB7A)    04145 Phagosome     103817017 (RAB7A)    04140 Autophagy - animal     103817017 (RAB7A)    04137 Mitophagy - animal     103817017 (RAB7A)    04148 Efferocytosis     103817017 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103817017 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scan04131]     103817017 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:scan04147]     103817017 (RAB7A)    04031 GTP-binding proteins [BR:scan04031]     103817017 (RAB7A) Membrane trafficking [BR:scan04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103817017 (RAB7A) Exosome [BR:scan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103817017 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    103817017 (RAB7A)   Exosomal proteins of colorectal cancer cells    103817017 (RAB7A)   Exosomal proteins of bladder cancer cells    103817017 (RAB7A) GTP-binding proteins [BR:scan04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103817017 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_24 AAA_22 AAA_16 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ATP-synt_ab FLYWCH_N Motif Other DBs NCBI-GeneID:  103817017 NCBI-ProteinID:  XP_030083818 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgatttcagtctctgggagttgccttctacagggga gcagattgttgtgtgctggtattcgatgtcacggctcccaacacgttcaaaaccctagac agctggagggatgaattcctcattcaggccagtccaagggatcctgagaattttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaggctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gaactttacaatgaattccccgaacccatcaaactagacaagactgaccgagcgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system