Serinus canaria (common canary): 103824084 Help Entry 103824084         CDS       T05755                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism scan  Serinus canaria (common canary) Pathway scan04010   MAPK signaling pathway scan04012   ErbB signaling pathway scan04068   FoxO signaling pathway scan04137   Mitophagy - animal scan04140   Autophagy - animal scan04144   Endocytosis scan04150   mTOR signaling pathway scan04210   Apoptosis scan04218   Cellular senescence scan04370   VEGF signaling pathway scan04371   Apelin signaling pathway scan04510   Focal adhesion scan04540   Gap junction scan04625   C-type lectin receptor signaling pathway scan04810   Regulation of actin cytoskeleton scan04910   Insulin signaling pathway scan04912   GnRH signaling pathway scan04916   Melanogenesis scan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103824084 (HRAS)    04012 ErbB signaling pathway     103824084 (HRAS)    04370 VEGF signaling pathway     103824084 (HRAS)    04371 Apelin signaling pathway     103824084 (HRAS)    04068 FoxO signaling pathway     103824084 (HRAS)    04150 mTOR signaling pathway     103824084 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103824084 (HRAS)    04140 Autophagy - animal     103824084 (HRAS)    04137 Mitophagy - animal     103824084 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103824084 (HRAS)    04218 Cellular senescence     103824084 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103824084 (HRAS)    04540 Gap junction     103824084 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103824084 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103824084 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103824084 (HRAS)    04912 GnRH signaling pathway     103824084 (HRAS)    04916 Melanogenesis     103824084 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103824084 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:scan04131]     103824084 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:scan04147]     103824084 (HRAS)    04031 GTP-binding proteins [BR:scan04031]     103824084 (HRAS) Membrane trafficking [BR:scan04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103824084 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103824084 (HRAS) Exosome [BR:scan04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103824084 (HRAS)   Exosomal proteins of colorectal cancer cells    103824084 (HRAS) GTP-binding proteins [BR:scan04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103824084 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103824084 NCBI-ProteinID:  XP_018779930 UniProt:  A0A8C9NIA7 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctcatccagaaccattttgttgatgagtatgatcccacaatagaggattcctac agaaagcaagtagtcatcgatggagagacctgtttgttagacatcttggacactgcaggg caggaggaatacagtgccatgagagaccagtacatgagaacgggggaaggattcctgtgt gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtatagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgtgacctc cctgcgcggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcacaagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system