KEGG   Streptomyces scabiei: SCAB_13581Help
Entry
SCAB_13581        CDS       T01187                                 

Definition
(GenBank) conserved hypothetical protein
Organism
scb  Streptomyces scabiei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1524643..1525653)
Genome map
AA seq 336 aa AA seqDB search
MGEAVELEAAGRTVRLSSPGKIFFPERGFTKLDLARYYIAVGPGILRALRDRPTTLERYP
EGVAGENFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEVAAVVWAAQFGTLTFHPWP
VRRADVDRPDELRIDLDPQPGTDYGDAVRAAHELREVLHEYGGLRGWPKTSGGRGLHVFV
PIRPDWTFTQVRRSAIAVARELERRMPEQVTTAWWKEERGAKIFVDYNQTARDRTIASAY
SVRPHPHAPVSAPLTWDEVGAAVPRDFDLGTMPSRFAEVGDVHADMDEHAFSLEALLELA
ARDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRARKG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagcggtggagctggaggcggcggggcggacggtacggctgtcgagcccggga
aagatcttcttcccggagcgcggcttcaccaagctggacctcgcccggtactacatcgcc
gtgggccccggcatcctgcgcgccctgcgcgaccggcccaccacgctggagcgctacccg
gaaggggtcgcgggcgagaacttcttccagaagcgggcccccaagaacatgcccgactgg
atccccaccgcccacatcaccttccccagcggccgcagcgccgacgagatgtgccccacc
gaggtcgccgccgtcgtgtgggccgcccagttcggcacgctcaccttccacccctggccg
gtccgccgcgccgacgtcgaccgccccgacgaactccggatcgacctcgacccccagccc
ggcaccgactacggggacgcggtgcgcgcggcgcacgaactgcgcgaggtgctgcacgag
tacggcgggctgcgcggctggcccaagacctccggcgggcggggcctgcacgtcttcgtg
ccgatccggccggactggaccttcacccaggtgcgccggtcggccatcgccgtggcccgc
gaactggagcgccggatgcccgagcaggtgaccacggcctggtggaaggaggaacgcggc
gcgaagatcttcgtcgactacaaccagaccgcccgcgaccgcaccatcgcctccgcctac
tccgtacggccccacccgcacgcgcccgtctccgcccccctcacctgggacgaggtcggg
gccgccgtgccgcgcgacttcgacctggggaccatgccgtcgcgtttcgccgaggtgggg
gacgtccacgccgacatggacgagcacgcgttctcgctggaggcgctgctggaactggcg
gcgcgggacgaacacgaccacggcctcggggatctgccgtatccgccggagtacccgaag
atgccgggcgagccgaagcgggtgcagccgagccgggccaggaagggctga

DBGET integrated database retrieval system