KEGG   Streptomyces scabiei: SCAB_13591Help
Entry
SCAB_13591        CDS       T01187                                 

Definition
(GenBank) putative DNA ligase
Organism
scb  Streptomyces scabiei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CBG68516
UniProt: C9Z888
LinkDB All DBs
Position
1525742..1526818
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPAMHYEAKWDGFRAIVFRDGAEVEIGSRTGKTLTRYFPE
LVAALRERLPERCVMDGEVVIVRGGHLDFDALTERIHPADSRVRMLAETTPASFVAFDML
ALNDESLLDVPLTDRRALLELALSEVTAPVHVAPATRDRELAERWFEQYEGAGLDGVIAK
PLDLRYRQDERAMFKIKHERTADVVIAGYRFHKSGPVVGSLLLGLYDAGGALQHIGVCAA
FTMKRRAELVAELEPWRLQDVGEHPWAAWAEEAAHDTARLPGAPSRWSAKKDFSWVPLRP
ERVAEVAYDHMENGVRFRHTARFRRWRPDRTAESCTYGQLEEPVTYDLAEILGPDAGP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatcttccggtgatgccgcccgtgaaaccgatgctcgccaagtccgtggcgaagatc
ccgccggccatgcactacgaggcgaagtgggacgggttccgggcgatcgtgttccgcgac
ggcgccgaggtggagatcggcagccggacgggcaagacgctgaccaggtacttccccgag
ctggtcgcggccctgcgcgagcggttgccggagcgctgtgtgatggacggcgaggtcgtc
atcgtgcggggcggtcatctggacttcgatgccctgaccgagcgcatccaccccgccgac
tcccgtgtccggatgctggcggagacgactccggcctccttcgtggccttcgacatgctc
gccctcaacgacgagtcgctcctcgacgtcccgctgaccgaccggcgcgcgctgctggag
ctggccctgtcggaggtgacggccccggtgcacgtggctccggcgaccagggaccgtgag
ctggcggagcggtggttcgagcagtacgagggggcgggtctggacggggtgatcgccaag
ccgctcgatctgcgctaccggcaggacgaacgggccatgttcaagatcaagcacgagcgg
acggcggacgtggtgatcgccggctaccgcttccacaagagcgggccggtggtcggctcc
ctgctcctgggcctgtacgacgccggcggcgccctccagcacatcggtgtctgcgcggcc
ttcaccatgaagcggcgcgcggaactggtggcggagctggagccgtggcgccttcaggac
gtgggggagcacccctgggcggcgtgggccgaggaggcggcgcacgacacggcccggctg
ccgggggcaccgagccggtggtcggcgaagaaggacttctcctgggtgccgctgcggccc
gagcgggtcgccgaggtcgcgtacgaccacatggagaacggcgtccgcttccgccacacg
gcccgcttccgccgctggcgccccgaccgtacggcggagagctgcacctacgggcagctg
gaggagccggtcacctacgacctggcggagatcctcggccccgacgccggtccctaa

DBGET integrated database retrieval system