KEGG   Streptomyces scabiei: SCAB_18021Help
Entry
SCAB_18021        CDS       T01187                                 

Definition
(GenBank) hypothetical protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scb  Streptomyces scabiei
Pathway
scb00250  Alanine, aspartate and glutamate metabolism
scb00410  beta-Alanine metabolism
scb00640  Propanoate metabolism
scb00650  Butanoate metabolism
scb01100  Metabolic pathways
scb01120  Microbial metabolism in diverse environments
Module
scb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_18021
   00650 Butanoate metabolism
    SCAB_18021
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAB_18021
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_18021
Enzymes [BR:scb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCAB_18021
Amino acid related enzymes [BR:scb01007]
 Aminotransferase (transaminase)
  Class III
   SCAB_18021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBG68932
UniProt: C9ZGG2
LinkDB All DBs
Position
complement(2031958..2033244)
Genome map
AA seq 428 aa AA seqDB search
MTDELLGRHKAVLPDWLALYYADPLEITHGEGRHVWDAAGTRYLDFFGGILTTMTAHALP
EVTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQMSGIPDARVFFTTSGTEANDTALMLA
TTHRRSNQILAMRNSYHGRSFSAVGITGNKGWSPTSLSPLQTLYVHGGVRTRGPYADLSD
ADFITACVADLEDLLGHGRPPAALIAEPVQGVGGFTSPPDGLYAAFREVLQRHGVLWIAD
EVQTGWGRTGDNFWGWQAHGQNGPPDILTFAKGIGNGMSIGGVVARSEVMNCLDSNSIST
FGGTQITMAAGLANLNYLIEHDLQGNARRVGGLLIERLRAITAQIPEVKEVRGRGLMIGI
ELVKPGTDEANPEAASAVLEAARREGLLIGKGGGHNTSALRIAPPLSLTVAEAEEGAEAL
ERALRSIR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaactgctcggacgccacaaggccgtactgcccgactggctcgcgctctac
tacgcggaccccctggagatcacccacggcgagggccgccacgtctgggacgccgccggc
acccggtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtcaccaaggcggtgagcgagcaggccgggcggatcatccactcctcgacgctctac
ctcaaccggccgatggtcgaactcgccgagcggatcgcccagatgtccggcatcccggac
gcccgggtcttcttcaccacctccggcaccgaggccaacgacaccgcgctcatgctggcg
acgacccaccgccgcagcaaccagatcctggcgatgcgcaacagctaccacggccgttcg
ttcagcgcggtcggcatcaccggcaacaagggctggtccccgacctcgctgtccccgctc
cagacgctgtacgtgcacggcggcgtccgcacccgcggcccgtacgccgacctgagcgac
gccgacttcatcaccgcctgcgtcgccgacctggaggacctgctcggccacggccgcccg
ccggccgcgctgatcgccgagccggtccagggcgtcggcggcttcacctcaccgccggac
ggcctgtacgcggccttccgcgaggtgctgcaacggcacggcgtgctgtggatcgcggac
gaggtgcagaccggctggggccgcaccggcgacaacttctggggctggcaggcgcacggg
cagaacggcccgccggacatcctcaccttcgccaagggcatcggcaacggcatgtccatc
ggcggtgtcgtggcccgctccgaggtcatgaactgtctggacagcaactcgatctcgacc
ttcggcggcacccagatcaccatggccgccgggctcgccaacctcaactacctgatcgag
cacgacctccagggcaacgcccggcgcgtcggcggactgctcatcgagcggctgcgggcg
atcaccgcgcagatcccggaggtgaaggaggtacgcggccggggcctcatgatcggcatc
gagctggtgaagcccggcaccgacgaggccaaccccgaggccgcgtccgccgtcctcgaa
gccgcccgccgcgagggcctgctgatcggcaagggcggcggccacaacaccagcgcgctg
cgcatcgcgcccccgctgtcgctgaccgtcgccgaggccgaggagggcgccgaagccctc
gaacgggctctgaggagcatccggtag

DBGET integrated database retrieval system