KEGG   Streptomyces scabiei: SCAB_36181Help
Entry
SCAB_36181        CDS       T01187                                 

Definition
(GenBank) putative glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scb  Streptomyces scabiei
Pathway
scb00564  Glycerophospholipid metabolism
scb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCAB_36181
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCAB_36181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069
Motif
Other DBs
NCBI-ProteinID: CBG70707
UniProt: C9YUX3
LinkDB All DBs
Position
complement(4092424..4094130)
Genome map
AA seq 568 aa AA seqDB search
MRTAALGPAQRAESLADMAERELDVLVVGGGVVGAGTALDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERWY
AGSGVALYDGMSMARGHGRGLPVHRHLTRAHALRVAPCLKKDALVGALQYYDAQMDDARY
VATLVRTAASYGAKVANRARVTGFLREGERVVGARVQDVEGGGEYEIRARQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLSRDDVQGVYAGLRPLLAGESDATSKLSR
EHIVAHPVPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDQRVAECVTEDVPLLGAEGYRAL
WNARARIAASTGLHVVRVEHLLNRYGSAAEEVLDLIASDPSLGEPLHAADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKDQIEREVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcggcactgggaccggcgcagcgcgccgagtcactggcggacatggccgag
cgtgagctggacgtgctggtcgtgggtggtggcgtggtcggtgcgggcacggccctggac
gccgtgacccgcggtctgtccacgggcctggtcgaggcgcgtgactgggcgtcgggcacg
tccagccggtccagcaaactgatccacggcggtctgcgctatctggagatgctcgacttc
gcgctcgtgcgtgaggcgctgaaggagcgcgggctgctcctggagcggctcgcgccccac
ctggtgaagcccgtgccgttcctctatcccttgcagcacaagggctgggagcggtggtac
gcgggctcgggcgtcgcgctgtacgacgggatgtccatggcgcgcgggcacggccgggga
ctgccggtccaccgccatctgacccgcgcccacgccctgcgcgtcgccccctgtctgaag
aaggacgcgctggtcggggccctgcagtactacgacgcccagatggacgacgcccgctat
gtggccaccctggtgcgcacggccgcgtcgtacggggcgaaggtcgccaaccgcgcgcgt
gtgaccgggttcctgcgggagggcgagcgggtggtcggggccagggtgcaggacgtcgag
ggcggcggggagtacgagatccgtgcccggcaggtcgtgaacgccaccggggtgtggacc
gacgacacccaggcgatggtgggcgagcggggccagttccacgtacgggcctccaagggc
atccatctggtcgtacccaaggaccggatccactccacgaccggtctgatcctgcggacc
gagaagtccgtgctgttcgtgatcccctgggggcggcactggatcgtggggacgaccgac
accgactgggacctcgacaaggcgcacccggcggcctccagcgcggacatcgactatctg
ctggagcatgtgaactcggtcctggccgtgccgctgagcagggacgacgtgcaaggggtc
tatgccgggctgcggcccctgctcgccggggagtcggacgccacgagcaagctctcgcgg
gagcacatcgtggcgcacccggtgccggggctggtggtcgtggccggcggcaagtacacg
acgtaccgggtgatggccaaggacgcggtggacgcggccgtgcacgggctggaccagcgg
gtcgcggagtgcgtcaccgaggacgtgccgctgctgggggcggaggggtaccgggcgctg
tggaacgcgcgggcgcggatcgcggcgagcacggggctgcacgtggtgcgcgtggagcat
ctgctgaaccggtacggctcggcggccgaggaggtgctcgacctgatcgcctccgacccg
tcgttgggggagccgttgcacgcggccgacgactatctgcgggccgaggtggtctacgcg
gcctcgcacgagggtgcccggcatctcgacgacgtgctcacccgcaggacgcggatctcc
atcgagacgttcgaccgcgggacgcgcagcgcgcgggaggccgcggagctgatggcgccg
gtgctcggctgggacaaggaccagatcgagcgggaggtgcagcactacgagaagagggtc
gaggcggagcgggagtcacagcgtcagccggacgatctgaccgcggacgcggcccggttg
ggggcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system