KEGG   Streptomyces scabiei: SCAB_66681Help
Entry
SCAB_66681        CDS       T01187                                 

Gene name
amlB
Definition
(GenBank) secreted alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAB_66681 (amlB)
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCAB_66681 (amlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7377077..7378459
Genome map
AA seq 460 aa AA seqDB search
MTSRTLSGALALAAGASIALTAPAGSAYASPPGTKDVTAVLFEWNFASVARECTSTLGPN
GYGYVQVSPPAEHIQGAQWWTSYQPVSYRIAGRLGDATAFKNMIDTCHAAGVKVVVDTVV
NHMSAGSGTGTGGSSYTKYDYPGLYSSFDFDDCTATISDYTNRANVQNCELVTLADLDTG
EEYVRSAIAGYMNSLLGYGVDGFRIDAAKHIPAADLANIKSRLTNSSVYWKQEAIHGSGE
AVQPGEYTGNGDVQEFRYAFDLKRVFTNENLAYLKNYGEGWGYMNSSVAGVFVDNHDTER
NGSTLSYKDNATYTLANVFMLAYPYGAPDINSGYEFSSTDAGPPDNGRVDACWQNGWKCQ
HAWPEIMRMVAFRNATRGEAVTDWWDNGSDAIAFGRGGKGFVAINHESSGLSRTYRTSLA
AGTYCNVQNNTTVTVNGSGQFTATLGAHTALALYAGKSSC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagaaccctgtccggcgcgctcgccctcgcggcgggcgcgtcgatcgccctc
acggcacctgccggaagcgcgtacgcgtcaccgcccgggaccaaggacgtgaccgccgtc
ctgttcgagtggaacttcgcctccgtcgccagggagtgcaccagcaccctcggaccgaac
ggctacggatacgtgcaggtctcgccgcccgccgagcacatacagggcgcgcagtggtgg
acgtcgtaccagcccgtcagctaccggatcgccggacggctcggtgacgccaccgccttc
aagaacatgatcgacacgtgccacgcggccggcgtcaaggtcgtcgtcgacaccgtcgtc
aaccacatgtcggccgggagcggcaccggcaccggcggctcgtcgtacacgaagtacgac
taccccgggctgtactcctccttcgacttcgacgactgcaccgccacgatcagcgactac
accaaccgtgccaacgtccagaactgcgaactcgtcaccctcgccgacctggacaccggc
gaggagtacgtcaggtcggcgatcgccgggtacatgaacagcctgctcgggtacggcgtc
gacggcttccggatcgacgccgcgaagcacatccccgccgccgacctggccaacatcaag
tcgcggctgaccaactcctccgtgtactggaagcaggaggccatccacggctccggcgag
gccgtccagccgggcgagtacaccggcaacggggacgtccaggagttccgctacgccttc
gacctcaagcgggtcttcaccaacgagaacctcgcctacctgaagaactacggcgagggc
tggggctacatgaacagctccgtcgccggggtcttcgtcgacaaccacgacaccgagcgc
aacggctccaccctcagctacaaggacaacgccacctacaccctcgccaacgtcttcatg
ctggcgtacccgtacggcgcgcccgacatcaactccggctacgagttctcctccaccgac
gccgggccgccggacaacggccgcgtcgacgcctgctggcagaacggctggaagtgccag
cacgcctggccggagatcatgcgcatggtcgccttccgcaacgccacccgcggtgaggcc
gtcaccgactggtgggacaacgggagcgacgcgatcgccttcgggcgcggcggcaagggc
ttcgtggccatcaaccacgagtcgagcggcctcagtcgcacctaccggacctcgctcgcg
gcaggcacctactgcaacgtgcagaacaacacgacggtcaccgtcaacggctccggccag
ttcaccgcgaccctcggcgcccacacggcactcgccctctacgcgggcaagagcagctgc
tga

DBGET integrated database retrieval system