KEGG   Treponema caldarium: Spica_1331Help
Entry
Spica_1331        CDS       T01573                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
scd  Treponema caldarium
Pathway
scd00440  Phosphonate and phosphinate metabolism
scd01100  Metabolic pathways
scd01120  Microbial metabolism in diverse environments
scd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Spica_1331
Enzymes [BR:scd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Spica_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA
Motif
Other DBs
NCBI-ProteinID: AEJ19477
JGI: Spica_1331
UniProt: F8F2T3
LinkDB All DBs
Position
1505064..1506362
Genome map
AA seq 432 aa AA seqDB search
MPIVYLGMIGDIIHPGIVNIVREASKHGDVLVGLFTDKAIASHKRLPYLSYEQRREVVEN
LKGVSRVVPQDEWSYVPNLRKYRPDFIIHGDDWKNGPESSLREEVFAVMAELGGSVIEIP
YTKGINSSALNESLKAIGTTPEIRMKTLRRLLAAKPIVRVLEAHSGLSGLIVENIEFEAP
DGKRFFDAMWSSSLTDSTVKGKPDIEAVDLTSRLQNLTDILECTTKPIIFDGDTGGLEEH
FVFTVRTLERHGVSAVIIEDKVGLKKNSLFGTEVKQELAPIDEFCSKISAGKRAQVTKDF
MIIARIESLIAGRDVNEALTRARSYVAAGADGIMIHSKEKSGNDIKEFCLSFRKDYPHVP
LVLVPTTYNRFTEDELASWGASIIIYANHLLRASYPAMVKAAELILANKRSLEADEICMP
IKEILELIPETK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgccaattgtctatttaggaatgataggtgatattattcatcctgggattgttaatatt
gtaagagaagcatcaaaacacggagacgtgctcgtggggcttttcaccgacaaggctatt
gccagccataagcgattaccctatttaagttatgaacaacgtcgtgaggttgtagagaac
ttaaaaggagtttccagggttgttcctcaggatgaatggtcctatgttcccaacttacgt
aaatatcgtcctgattttattattcatggggatgattggaaaaatggtcctgaaagctct
ctccgggaagaagtctttgcagttatggctgaactcggggggagtgttattgaaatacct
tacacaaaggggattaactcgagtgcccttaatgaaagtctcaaagccattgggactacg
cctgaaatacgcatgaagaccctcaggcgacttttagccgcaaaacctatcgtacgagtt
ctagaagcccattcaggtttgtccgggcttattgtagaaaatatcgaattcgaggccccc
gatggtaagcgattcttcgatgccatgtggtcatccagtttaaccgattctaccgtaaag
ggtaagccggatatagaagcggtagatttgacatcacggctacagaatttaaccgacata
ttagaatgtacaacaaaacctattatttttgatggagataccggtgggctcgaagaacac
tttgtgtttactgtccgcacccttgaacgtcatggagtttcagcggtaattattgaagat
aaggttggcctcaagaaaaactccctttttgggactgaagttaaacaggaattagctcca
attgatgaattttgttctaaaattagtgccggaaaacgtgcacaggtaacaaaagacttt
atgattattgcccgcatcgaaagccttattgccggaagggatgtgaatgaggcacttacc
cgggccaggtcctatgttgccgccggtgctgatggtattatgatacatagtaaagaaaaa
tcgggtaatgacattaaggaattctgtctatcctttaggaaagactatcctcatgttccg
ctcgtattggtacctacgacctataatcgttttaccgaagatgaactagcatcctggggg
gcaagcattataatttatgcaaatcatttacttcgtgcttcctaccctgctatggtaaaa
gcagcagagctaattcttgccaataaacgatccctcgaagctgatgaaatttgtatgcct
ataaaagaaattctagaattaattccggagacaaaataa

DBGET integrated database retrieval system