KEGG   Treponema caldarium: Spica_1331Help
Entry
Spica_1331        CDS       T01573                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
scd  Treponema caldarium
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Spica_1331
Enzymes [BR:scd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Spica_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1505064..1506362
Genome map
AA seq 432 aa AA seqDB search
MPIVYLGMIGDIIHPGIVNIVREASKHGDVLVGLFTDKAIASHKRLPYLSYEQRREVVEN
LKGVSRVVPQDEWSYVPNLRKYRPDFIIHGDDWKNGPESSLREEVFAVMAELGGSVIEIP
YTKGINSSALNESLKAIGTTPEIRMKTLRRLLAAKPIVRVLEAHSGLSGLIVENIEFEAP
DGKRFFDAMWSSSLTDSTVKGKPDIEAVDLTSRLQNLTDILECTTKPIIFDGDTGGLEEH
FVFTVRTLERHGVSAVIIEDKVGLKKNSLFGTEVKQELAPIDEFCSKISAGKRAQVTKDF
MIIARIESLIAGRDVNEALTRARSYVAAGADGIMIHSKEKSGNDIKEFCLSFRKDYPHVP
LVLVPTTYNRFTEDELASWGASIIIYANHLLRASYPAMVKAAELILANKRSLEADEICMP
IKEILELIPETK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgccaattgtctatttaggaatgataggtgatattattcatcctgggattgttaatatt
gtaagagaagcatcaaaacacggagacgtgctcgtggggcttttcaccgacaaggctatt
gccagccataagcgattaccctatttaagttatgaacaacgtcgtgaggttgtagagaac
ttaaaaggagtttccagggttgttcctcaggatgaatggtcctatgttcccaacttacgt
aaatatcgtcctgattttattattcatggggatgattggaaaaatggtcctgaaagctct
ctccgggaagaagtctttgcagttatggctgaactcggggggagtgttattgaaatacct
tacacaaaggggattaactcgagtgcccttaatgaaagtctcaaagccattgggactacg
cctgaaatacgcatgaagaccctcaggcgacttttagccgcaaaacctatcgtacgagtt
ctagaagcccattcaggtttgtccgggcttattgtagaaaatatcgaattcgaggccccc
gatggtaagcgattcttcgatgccatgtggtcatccagtttaaccgattctaccgtaaag
ggtaagccggatatagaagcggtagatttgacatcacggctacagaatttaaccgacata
ttagaatgtacaacaaaacctattatttttgatggagataccggtgggctcgaagaacac
tttgtgtttactgtccgcacccttgaacgtcatggagtttcagcggtaattattgaagat
aaggttggcctcaagaaaaactccctttttgggactgaagttaaacaggaattagctcca
attgatgaattttgttctaaaattagtgccggaaaacgtgcacaggtaacaaaagacttt
atgattattgcccgcatcgaaagccttattgccggaagggatgtgaatgaggcacttacc
cgggccaggtcctatgttgccgccggtgctgatggtattatgatacatagtaaagaaaaa
tcgggtaatgacattaaggaattctgtctatcctttaggaaagactatcctcatgttccg
ctcgtattggtacctacgacctataatcgttttaccgaagatgaactagcatcctggggg
gcaagcattataatttatgcaaatcatttacttcgtgcttcctaccctgctatggtaaaa
gcagcagagctaattcttgccaataaacgatccctcgaagctgatgaaatttgtatgcct
ataaaagaaattctagaattaattccggagacaaaataa

DBGET integrated database retrieval system