KEGG   Saccharomyces cerevisiae (budding yeast): YOR005CHelp
Entry
YOR005C           CDS       T00005                                 

Gene name
DNL4, LIG4
Definition
(RefSeq) DNA ligase (ATP) DNL4
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    YOR005C (DNL4)
Enzymes [BR:sce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YOR005C (DNL4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     YOR005C (DNL4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
XV:complement(334509..337343)
Genome map
AA seq 944 aa AA seqDB search
MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM
WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG
KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC
VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR
LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK
FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS
AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS
SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI
VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI
ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD
NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI
RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG
KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC
FNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFL
FSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE
KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagcactagattctatacccgagccccaaaactttgcgcctagtccagatttc
aaatggctttgtgaagagctatttgtgaagatacatgaagttcaaattaatggaacggcc
ggcactggcaaatcaaggtctttcaagtactatgaaataatatcgaatttcgtcgaaatg
tggagaaaaaccgtgggaaataatatatatcctgcactggttcttgctcttccctaccgc
gatagacgaatctataatattaaggattatgtattaataagaactatatgctcttacttg
aagttgccaaaaaattctgcaacagagcagcggttaaaagattggaaacagcgtgtcggt
aaaggtgggaatctttcttctcttcttgtggaagaaattgctaaaagaagggctgaacct
agctcaaaagcgattacaattgataacgtcaatcactatctggatagtttgagtggagac
aggttcgcttccggacgaggatttaagagtcttgtcaagtccaaacctttcctgcactgt
gtggagaatatgagtttcgtcgaattaaaatacttctttgatatcgtgcttaaaaataga
gtaataggaggtcaagagcacaaattgctaaactgctggcatcctgatgctcaggattat
cttagcgtgatatctgatttaaaggtggtaacttcaaaactttatgatccaaaagttcgt
ctaaaggatgatgatttgagtataaaagttggctttgcattcgccccccaattagccaaa
aaagtgaatctttcttatgagaaaatatgccgtacactacatgatgattttttggtagaa
gaaaaaatggatggagaacgaattcaagttcattatatgaattatggtgaatccataaaa
ttttttagtagacggggcatcgactatacctatttgtacggagcgagcttatcatcagga
actatatctcaacatttgaggtttacagatagtgttaaagaatgtgttttagatggagaa
atggtgacgtttgatgcaaaaagacgggtgattcttccattcggtcttgttaaaggaagt
gcaaaggaagcgctatcttttaatagtataaataatgttgactttcaccccttatatatg
gtgtttgatctgttatacctgaatgggacttcgttgacaccattaccccttcatcaaagg
aagcaatatctgaacagcattttaagtcccttgaaaaatattgtagaaatagtacgatct
tctagatgttatggtgtggagtcaatcaaaaagtctttagaagttgcaatctcactgggt
tcagaaggagttgttttgaaatattataattcaagttataatgtcgccagtcgaaacaac
aactggatcaaggtaaaacctgaatatttggaggaatttggagagaatttagacttaata
gtaataggcagagattctgggaaaaaagattcttttatgctagggttacttgtgctagat
gaagaagagtataaaaagcaccaaggagactcctctgaaattgtagaccactcaagccaa
gaaaaacacatacaaaattcaagaagaagggtgaaaaaaatactttcattctgttctatc
gcaaacggtatatctcaagaagaattcaaagaaatcgaccgcaaaacgagaggacattgg
aaaagaacctccgaagttgctccccctgcttcaattttagaatttggctcaaaaatacct
gccgaatggattgaccccagtgaatcaattgttctagaaataaaatcacggtctttggat
aacacagaaacgaatatgcagaagtacgctaccaattgtactttgtacggtggctattgt
aaaagaatacggtacgataaagaatggacagattgttacacacttaacgacttatacgaa
agtaggacggttaaatctaaccccagctatcaagcggaaaggtcacagcttggattgata
cggaaaaagagaaagagagtacttatttcagacagctttcaccaaaacaggaaacaactg
ccaatttcaaacatctttgccggattacttttttatgttctctctgactatgtcacggag
gacactggaatacggattacacgggcagaacttgaaaaaactattgtggaacatggtggt
aaactgatatataatgtaattttaaaacgtcattcaattggggacgttcggttaatcagc
tgtaaaactaccacggaatgcaaggctttaatagatcgaggatatgatatattgcaccca
aattgggtactcgattgtatagcatataagaggctcatcctgatcgagcccaattattgc
tttaacgtctctcaaaaaatgagagccgtcgctgaaaaaagggtagattgtttgggtgat
agttttgaaaatgacatttcggaaaccaaactgtcatcattgtataaatcacaactaagt
ctaccaccgatgggggaactcgagatagattctgaggttcggcggtttccattattttta
ttctccaacaggattgcatacgtaccacgtcgcaaaattagcacagaagatgacattata
gaaatgaaaattaagttgtttggtggaaaaataacagatcaacagtcactttgtaactta
ataattataccatatactgatcctattttgaggaaagactgcatgaatgaggtacacgaa
aaaataaaagaacaaataaaggcttctgatactataccgaaaatagccagggtcgttgcc
cctgaatgggtggatcattctattaatgaaaactgtcaagtgcctgaagaagacttcccc
gtagtcaactactga

DBGET integrated database retrieval system