KEGG   Streptomyces collinus: B446_30625Help
Entry
B446_30625        CDS       T02787                                 

Definition
(GenBank) hypothetical protein
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGS72929
UniProt: S5VCP0
LinkDB All DBs
Position
7080228..7081271
Genome map
AA seq 347 aa AA seqDB search
MGDAVELEVAGRTVRLSSPDKVFFPERGFTKLDLARYYAAVGPGILRALRDRPTTLERHP
DGVGGEWFYQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWP
VRRTAVDHPDELRIDLDPQPGTDYADAVRAAHELREVLHEYGGLRGWPKTSGGRGLHVFV
PIQPRWTFTQVRRAAIAVGREMERRMPEQVTIKWWKEERGARIFLDYNQTARDRTIASAY
SVRPRPHAPVSAPLRWEEVGEAAPRDFDLATMPARFAEVGDVHADMDDHAYSLEALLELA
SRDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRARREGTGRARTEGTG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcggtggaactggaagtggccggccggaccgtacgcctgtccagcccggac
aaggtcttcttccccgagcgcggcttcaccaagctggacctggcccggtactacgccgcc
gtcggccccggcatcctgcgcgccctgcgcgaccgccccaccaccctcgaacgccatccg
gacggtgtcggcggcgagtggttctaccagaagcgcgcgcccaagggcatgcccgactgg
atcccgaccgcccacatcaccttccccagcggccgcagcgcggacgagatgtgccccacg
gaggaggccgccgtcgtgtgggccgcccagtacggcacgctcaccttccacccctggccg
gtgcgccgcaccgcggtcgaccaccccgacgaactgcgcatcgacctcgacccgcagccc
ggcaccgactacgccgacgccgtccgcgccgcccacgaactgcgcgaggtgctgcacgag
tacggcggcctgcgcggctggccgaagacctccggcggccggggcctgcacgtcttcgtc
cccattcaaccgcgctggaccttcacccaggtgcggcgcgccgccatcgcggtcggccgg
gagatggaacgccggatgcccgagcaggtcaccatcaagtggtggaaggaggaacgcggc
gcacgcatcttcctcgactacaaccagaccgcccgtgaccgcaccatcgcctccgcctac
tccgtacggccccgcccgcacgcccccgtctccgcgcccctgcgctgggaggaggtcggt
gaggccgctccccgcgacttcgacctcgccaccatgccggcccgcttcgccgaagtcggc
gacgtgcacgccgacatggacgaccacgcctactccctggaagcgctcctggagctggcc
agccgcgacgaacacgaccacggcctgggcgacctgccctacccgccggagtacccgaag
atgccgggcgaaccgaaacgcgtccagccgagccgcgcccgcagggagggcacgggccgc
gcccgcacggagggcacgggctga

DBGET integrated database retrieval system