KEGG   Sorangium cellulosum So ce56: sce3523Help
Entry
sce3523           CDS       T00634                                 

Definition
(GenBank) unnamed protein product; High confidence in function and specificity
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:scl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    sce3523
Enzymes [BR:scl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     sce3523
DNA repair and recombination proteins [BR:scl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     sce3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CAN93683
UniProt: A9GRV1
LinkDB All DBs
Position
complement(4924177..4926465)
Genome map
AA seq 762 aa AA seqDB search
MSSSAGRATAWERETTGRRRCHCGIGIAFSTKRDGGTMMAGQRQAQGAARRTRAVRPATL
TARRKRGETAADLDSQRSSAATGEADSTAAIPRPTLTYADALEGARKGPFPGEIEPQLAT
LVTGPPPGEGWLYEVKLDGYRMLAKLRGGRVTLQTRRGQDWTERFAAVRDDLARLPAREA
VLDGEIVVVRPDGVTDFQALQNALSDGNGRREGRLMYFVFDLLYLDGRDLRGCTQVTRKR
ALEALLAEAPEEGHLRYTEHVAEDGSAVVQHACELGIEGVIAKRPEAPYRSGRGDSWLKV
KCGRRQEFVIVGFTEPSGARKGLGAILVGVNRSGKLAYAGKVGTGFTGKTLTTLRSRLDA
IVRATPACSGAPRMRGARWVEPRLVAEVRFSEWTRDGRLRHPSFEGLREDRTPESVTVER
EQPPPQSPPGEAAGAAPSRAAGAPPRRTASTAGGKSPRGGRSRGAAERVEVAGVPLTNPD
KVLYPAQGITKLALARYYEQIAEHMLTHAEKRLLTLVRCPAGQGKPCFFQRHEAEGLSQA
IQRMAVEEDDGERTYLYIETTEGLVSLVQMGALEVHLWGSRVDRIEQPDRMVFDLDPAPD
LPWERVADAARTARRLLSSLGLRSFVKTTGGKGLHVVVPIAPRRGWDEVKAFTKAVADAL
VRSDPARYTATMSKAKRAGKVFVDYLRNGRGATAVAPYSTRARPGAAVATPLSWDELDAP
LDPASFTIDTVPQRLAAIRDPWAELTSVRQSITSAMLKQVEL
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagctcagccggccgcgccacggcctgggaacgggaaaccaccggaaggcgacga
tgccattgcggtatcggaattgctttttccaccaaaagagacggtggcacgatgatggcc
ggacaaagacaggcacaaggcgcggcgcggcggactcgagcggtgcgaccagcaaccctg
accgcccgtcgcaaacgcggggaaacggcggctgacctggacagccagcgctcgtccgcg
gcgacgggagaggccgactccaccgcagcgatcccgcgcccgacgctgacctacgcggat
gcgctcgagggcgcccggaaagggccgttcccgggcgagatcgagccccagctcgcgacg
ctcgtcaccgggccacccccgggcgaggggtggctctacgaggtcaagctcgatgggtat
cgcatgctcgcgaagctccgcgggggccgcgtgacgctccagacccgccgcggccaggac
tggaccgagcggttcgcggccgtgcgcgacgacctcgcccggctgcctgcgcgggaggcc
gtgctggacggcgagatcgtcgtcgtgaggccggacggcgtgaccgacttccaggccctc
cagaacgcgctcagcgacgggaatggcaggcgcgaggggcgcctgatgtacttcgtcttc
gacctgctctacctcgacggccgcgatctccgcgggtgcacacaggtcacccgcaagcgg
gcgctcgaggcgctgctcgcggaagcgcccgaggaagggcacctgcgctacacggagcac
gtcgcggaggacggctccgccgtcgtccagcacgcgtgcgagctcgggatcgagggcgtc
atcgcgaagcgcccggaggctccctaccggagcgggcgcggcgacagctggctcaaggtg
aagtgcggccggcgccaggagttcgtgatcgtcggcttcaccgagccgtccggcgcccgg
aaagggctgggggcgatcctcgtcggcgtgaacaggtcaggcaagctcgcctacgccggc
aaggtgggcacgggcttcacgggcaagacgctgacgaccctgcgcagccgcctcgacgcg
atcgtacgcgccacgccagcctgttcaggggcgccgcgcatgcggggggcgcgctgggtc
gagcccaggctcgtcgcggaggtccgcttttccgagtggacgcgcgacggacggctgcga
cacccctccttcgaagggctccgcgaggaccgcaccccggagtcggtcaccgtcgagcgc
gaacagccgccgccgcaatcgccgcccggcgaggcagcgggcgcggcgccgagcagagcg
gccggcgccccgccgaggaggaccgcgagcacggcggggggcaagtccccgcgcgggggc
cggagcagaggcgccgcggagcgggtcgaagtcgccggggtgccgctgacgaaccccgac
aaggtgctctatcccgcgcaggggatcacgaagctcgcgctggcccggtattacgagcag
atcgccgagcacatgctgacccacgccgagaagcggctgctcacgctggtccgctgcccc
gcaggccagggcaagccatgcttctttcaaaggcacgaggccgaggggctgtcccaggcg
atccagcggatggccgtcgaggaggacgacggcgagcgcacctatctctatatcgagacc
accgaagggctcgtgtcgctcgtccagatgggggcgctcgaggtgcacctctgggggagc
cgcgtggaccggatcgagcagcccgacaggatggtgttcgacctcgatccagcgccggat
ctcccgtgggagcgcgtggcggacgcggcgaggacggcgcggcgcctcctttcgtcgctc
gggctgcggagcttcgtcaagacgaccggcggcaagggcttgcacgtcgtggtcccgata
gcgccacgcaggggctgggacgaggtgaaggcgttcacgaaggccgtggccgacgcgctc
gtgcgctccgacccggcgcggtacaccgcgacgatgtcgaaggcgaagcgcgccggcaag
gtcttcgtcgactacctgcggaacgggcgcggcgccaccgctgtggcgccctactcgacg
cgagcgcgtcccggcgcggccgtcgcgacgccgctctcgtgggacgagctcgacgcgccg
ctcgatcccgcctcgttcaccatcgacaccgtgccgcagcggctcgccgcgatccgggac
ccatgggcagagctcacgagcgtgcgccagtcgatcaccagcgcgatgctgaaacaggtc
gagctttga

DBGET integrated database retrieval system