KEGG   Solitalea canadensis: Solca_1153Help
Entry
Solca_1153        CDS       T02084                                 

Definition
(GenBank) glycosyltransferase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
scn  Solitalea canadensis
Pathway
scn00500  Starch and sucrose metabolism
scn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Solca_1153
Enzymes [BR:scn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Solca_1153
Glycosyltransferases [BR:scn01003]
 Polysaccharide
  Storage polysaccharide
   Solca_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AFD06257
UniProt: H8KTC0
LinkDB All DBs
Position
complement(1372988..1374802)
Genome map
AA seq 604 aa AA seqDB search
MQLEKKLLVEIAWEVCNQVGGIYTVIRSKAPAMVDIWGDNYCLIGPMFPGKMPAEFEPTD
KYNDAFGRAVLKMQKLGFEVHYGYWLVSGKPKVILINFAPIYSRLHEVKYFLWENHKIDT
SSFDELVDQTIAFGETVKQLLEQLAQPGTTTKKIHAHFHEWMVGTPIAHIKKNALPIKTV
FTTHATQLGRYLATTTPRFYDILPGVNWEKEARRFNCLSKVLIERSAAQNADVFTTVSEI
TGSECEILIGRKPDVITPNGINIERFVALHEFQNLHVEYKQKINQFVMGHFFHNYSFDLE
NTLYFFTSGRFEYVNKGFDLTIDAIDRLNKKMKKSGIDVTVVLFIITKQEYHSINSKVLH
SRALMEEVRDTCTAIRKQVGDKLFLASAYNPDQKMPALNDFVDDYWKLRLRRTLLSWKND
ELPYIVTHDLVDNHNDQIVNHLRRVNMVNEKNDRVKIVYHPDFISPTNPLFGLEYHQFIR
GCHLGVFPSYYEPWGYTPLECIASGIPTVTSDLSGFGDYVLSNLPSEESHGIYIVRRRHN
DYTKAAESLANMLFSFVQLTRRERISQRNMVESSSENFDWKYLVKYYRDAYQLIIEDDSV
TEEI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagagaagaaacttttagtcgaaatcgcttgggaagtatgtaaccaggttggg
ggcatttatacggttattcgttctaaggctcctgcaatggttgatatatggggcgataat
tattgcctgatcgggcctatgttcccaggaaaaatgcctgcagagtttgaacctaccgac
aaatacaatgatgcttttggacgtgccgtactaaaaatgcaaaaacttggttttgaggtt
cattatggctattggctggtatccggcaaacctaaagttatcctgatcaattttgctcct
atctacagccgattacatgaggtcaaatatttcctttgggaaaatcacaaaatcgatact
tccagttttgatgaattagttgaccaaaccattgcgtttggagaaactgtaaaacaatta
ctggaacaactcgcccaacctggcactacaaccaaaaaaattcatgcacattttcatgaa
tggatggtaggcacaccgatagcgcatatcaaaaaaaatgcattaccgataaaaacggta
tttaccactcacgccacccaattaggaaggtatcttgctactacaacaccacgattctat
gatattttaccgggtgtaaactgggaaaaggaagctcgcagattcaattgcctatcaaaa
gtactaattgaacgaagtgcggctcaaaatgcagatgtatttactacggtaagtgaaatt
accggctctgaatgtgaaatactgattggaagaaaacccgatgtaattactccaaatgga
attaacatcgaacgttttgtggccttgcatgagtttcaaaatttacatgtggagtataag
caaaagatcaatcagtttgtaatgggacatttctttcataactattcttttgatcttgaa
aatacgctttacttttttacttccggaagatttgaatatgtgaacaaaggatttgaccta
acgatagatgcgattgaccggctgaataaaaaaatgaagaaatcaggtattgatgttacg
gttgttttattcataattaccaaacaagagtatcattccatcaactcaaaagtgttgcat
tcacgtgcgctgatggaagaagttagggatacctgtacagcgataagaaaacaggttggc
gataagctttttcttgcttctgcctataatcctgatcaaaaaatgccggctcttaatgat
tttgttgatgattactggaaattacgtttacgtagaacattgttgagctggaaaaatgac
gaactaccctatattgttacgcatgatttggtagataatcataatgatcagattgtaaat
catctgcgacgtgtaaacatggtgaacgaaaaaaatgatagggttaaaatcgtttatcac
ccagactttatctctcctaccaatcctttatttggcctggaatatcatcaatttatcaga
ggttgccatttaggtgtatttccaagctactatgaaccctggggatacacaccgctagaa
tgtatagccagtggcattcctactgttacaagtgatctttccggctttggcgattatgta
ttgagcaatttgcctagcgaggaatcacatggtatctatattgttcgccgtcggcataac
gattacaccaaagccgccgaatcattagctaatatgctttttagttttgtacagctaacc
cgacgagaacgcatctcacaacgaaatatggtagaaagttcatcggaaaatttcgactgg
aaatacctggttaaatactatagagatgcttatcaattaattatcgaagacgattcagtt
actgaagaaatttaa

DBGET integrated database retrieval system