KEGG   Streptomyces coelicolor: SCO1202Help
Entry
SCO1202           CDS       T00085                                 

Gene name
ligB
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SCO1202 (ligB)
   03410 Base excision repair
    SCO1202 (ligB)
   03420 Nucleotide excision repair
    SCO1202 (ligB)
   03430 Mismatch repair
    SCO1202 (ligB)
Enzymes [BR:sco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCO1202 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     SCO1202 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SCO1202 (ligB)
DNA replication proteins [BR:sco03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SCO1202 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SCO1202 (ligB)
DNA repair and recombination proteins [BR:sco03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SCO1202 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     SCO1202 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     SCO1202 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
1273700..1275238
Genome map
AA seq 512 aa AA seqDB search
MLLARLAQVSREVAATSARSRKTVLLAELFREAEAADVPVVIPYLAGRLPQGRIGVGWKV
LSRRVPPADAPTLTVRDVDARLTRLGAVSGAGSQAERTRLVGELMGAATEDEQRFLIGLL
TGEVRQGALDAAAVEGLAAATDAPPADVRRAVMLAGSLQTVAEALLADGPGALDRFRLTV
GQPVLPMLAHSASSVAEAVGKLGAAAVEEKLDGIRVQVHRDGGTVRIYTRTLDDITDRLP
EVTEAALALPGERFILDGEAISLDADGRPRSFQETAGRVGSRTDVATAARAVPVSAVFFD
VLSVDGRDLLDLPLTERHAELARLVPEPLRVRRTLVHGPEDTGAAEEFLARTLARGHEGV
VVKGLDAAYSAGRRGASWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARTADGSFA
MLGKTFKGMTDALLTWQTERLKELAVEEHGWGVTVRPELVVEIAYDGLQRSTRYPAGVTL
RFARVVRYREDKRPEDADTVDTLLAAHPGVAP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgcccggttggcccaggtgtcccgggaggtcgcggccacgtcggcgcggtcc
cggaagaccgtcctgctcgcggagctgttccgtgaggcggaggcggcggacgtgccggtc
gtcatcccgtacctggcgggacggctcccgcagggccggatcggcgtcggctggaaggtg
ctgagccgccgcgtgccgcccgcggacgcaccgaccctgaccgtacgtgacgtggacgcc
cgcctcacccggctcggcgcggtctccggcgccggttcgcaggccgagcggacccggctg
gtcggcgagctgatgggcgccgccacggaggacgagcagcgcttcctgatcgggctgctc
accggggaggtccgccagggcgccctggacgcggccgccgtcgagggcctggccgcggcg
acggacgctcccccggcggacgtgcggcgggcggtgatgctcgcggggtcgctccagacc
gtggccgaagccctgctggccgacggacccggcgccctcgaccggttccggctcaccgtg
gggcagccggtgctgccgatgctggcgcacagcgcgtcctcggtcgccgaggcggtcggc
aaactgggcgccgccgcggtggaggagaagctggacggcatccgcgtccaggtgcaccgg
gacggcggcaccgtgcggatctacacccgcacgctggacgacatcaccgaccggctcccc
gaggtcaccgaggcggccctggcactgcccggcgagcggttcatcctggacggcgaggcg
atctccctcgacgcggacgggcgcccccgctccttccaggagaccgccggccgggtcggc
tcccgcaccgacgtggccacggccgcgcgggcggtcccggtctccgcggtcttcttcgac
gtactctccgtcgacggccgcgacctgctcgacctgccgctgaccgaacggcacgcggag
ctggcgcggctggtccccgagcccctgcgggtacggcgcactctggtgcacggccccgag
gacaccggtgcggcggaggagttcctcgcccggacgctggcgcgcgggcacgagggcgtc
gtcgtcaaggggctcgacgccgcctacagcgcgggacggcgcggcgcgtcctggctgaag
gtcaagccggtccacacgctcgacctggtggtgctggccgccgagtggggccacggccgc
cgcaccggcaagctctccaacctccacctgggcgcccgcaccgccgacggctccttcgcg
atgctcggcaagaccttcaagggcatgaccgacgcgctgctgacctggcagaccgagcgc
ctgaaggagctggccgtggaggagcacggctggggcgtgaccgtacgccccgagctcgtc
gtcgagatcgcctacgacggcctccagcgctccacccgctacccggccggcgtcaccctc
cgcttcgcgcgcgtggtccgctaccgcgaggacaagcgccccgaggacgcggacaccgtg
gacaccctgctcgccgcccaccccggggtggccccgtga

DBGET integrated database retrieval system