KEGG   Streptomyces coelicolor: SCO6412Help
Entry
SCO6412           CDS       T00085                                 

Gene name
SC1A6.01, SC3C8.31
Definition
(RefSeq) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO6412 (SC1A6.01)
   00650 Butanoate metabolism
    SCO6412 (SC1A6.01)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO6412 (SC1A6.01)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO6412 (SC1A6.01)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCO6412 (SC1A6.01)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO6412 (SC1A6.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
7078585..7079868
Genome map
AA seq 427 aa AA seqDB search
MTRDLFARHRAVLPDWLALYYEDPLEITHGEGRYVWDAAGNKYLDFFGGILTTMTAHALP
EVTKAVAEQAGRIVHSSTLYLNRPMVELAERVAQLSGIPDARVFFTTSGTEANDTALLLA
TAYRRSNAILAMRNSYHGRSFSTVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYADLDD
RDFIDACVTDLKDLLGHSRAPAALIAEPVQGVGGFTSPPDGLYAAFREVLHERGILWISD
EVQTGWGRTGEHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVVARAEIMNCLDANSIST
FGGTQVTMAAGLANLNHLLEHDLQGNARRVGGLLIERLRAVAAQVPHVREVRGRGLMIGV
ELTRPGTDEAAPEAASTVLEEARAGGLLVGKGGGHSTSVLRIAPPMSLTVAEAEEGAAIL
ERALRSI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtgacctcttcgcccgccaccgcgccgtcctgcccgactggctcgccctctac
tacgaggacccgctggagatcacccacggcgagggcaggtacgtctgggacgccgcaggc
aacaagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtcaccaaggccgtcgccgagcaggccggtcggatcgtccactcctcgaccctctac
ctcaaccggccgatggtcgaactcgccgaacgcgtcgcccagctgtccggcatccccgac
gcccgcgtcttcttcaccacctcgggcaccgaggccaacgacacggccctgctgctcgcc
accgcataccggcgcagcaacgcgatcctggcgatgcgcaacagctaccacggccgctcc
ttcagcaccgtcggcatcaccggcaaccgcggctggtccccgacctccctgtccccgctc
cagaccctgtacgtgcacggcggcgtccgcacccgcgggccctacgcggacctggacgac
cgggacttcatcgacgcctgcgtcaccgacctcaaagacctgctcggccacagccgcgcc
cccgccgccctgatcgccgaacccgtccagggcgtcggcggcttcacctccccgccggac
ggcctgtacgccgccttccgcgaggtgctgcacgagcggggcatcctgtggatctccgac
gaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcgcacgca
aggagcggcccgcccgacatcgtcaccttcgccaagggcatcggcaacggcatgtcgatc
ggcggggtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacc
ttcggcggcacccaggtcaccatggccgcgggcctcgccaacctcaaccacctcctggag
cacgacctccagggcaacgcccggcgcgtcggcggactgctcatcgaacgcctgcgcgcc
gtcgccgcccaggtgccgcacgtgcgcgaggtacgcgggcgcggactgatgatcggcgtg
gagctgacccggcccggcaccgacgaggccgcccccgaggcggcgtccaccgtactggag
gaggcccgcgccggcgggctgctcgtcggcaagggcggcggccacagcaccagcgtcctg
cgcatcgccccgccgatgtccctcaccgtcgcggaggccgaggagggcgccgcgatcctc
gaacgcgccctgcggagcatctga

DBGET integrated database retrieval system