KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0865Help
Entry
SCRE_0865         CDS       T02833                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCRE_0865 (acoC)
   00020 Citrate cycle (TCA cycle)
    SCRE_0865 (acoC)
   00620 Pyruvate metabolism
    SCRE_0865 (acoC)
Enzymes [BR:scon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCRE_0865 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(880895..881980)
Genome map
AA seq 361 aa AA seqDB search
MLPRPMNYLRMREIMDDKKLRATPAARKLADDLGINLYDVSGSGSNGRVHKEDVETYQDT
HAVRISPLAKRIAEEHNIAWNEIQGTGHRGKIMKKDVLAFLPENVESDSIKSPAVIEKVE
EVPDNITPYGEIERIPMTPMRKVIAQRMVDSYLTAPTFTLNYDVDMTEMLALRKKVIDPI
MEATGKKVTVTDLLSLAVVKTLMKHPYLNSSLTEDGKTIITHNYVNLAMAVGMDNGLMTP
VVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMLGVQSFGPIINQPN
SAILGVSATIEKPVALNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISML
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctcgaccaatgaattatttaagaatgagagagatcatggatgacaaaaaatta
agagcgacccctgcagctagaaagctggcagacgatctgggaatcaatctttacgatgtt
tccggttcaggctcaaacggtcgcgtccacaaggaagacgtggaaacctatcaagatacc
catgcggttcggatttcaccgctggccaagcgcattgccgaggagcacaatatcgcctgg
aatgagattcagggaactgggcaccgcggcaagattatgaagaaggatgtcctggccttc
ttgcctgaaaatgtcgaaagtgacagcatcaagtcgccggctgttattgaaaaggttgaa
gaagtaccagataatatcacgccttacggtgagattgagcgtattccaatgacaccgatg
cgcaaggttatcgcccaacggatggtggattcctatctgacggcgccgacctttaccctc
aactatgatgtggatatgacggaaatgctggccctacgcaagaaggttatagatccaatc
atggaagcgaccggcaagaaggtgacggtcacagatttgctgtcgttggctgtggttaag
accctgatgaagcacccttatctcaattcctctctgaccgaggacggcaagaccatcatc
acccacaactatgtcaatctggccatggctgtcggtatggataatggtctcatgacgcct
gtagtctacaatgctgagaagatgagcctgtctgagctagttgtggccttcaaggatgtc
atcggccggaccctggatggcaagctggcaccgagcgagctgcaaaattctaccttcacc
atcagcaatctgggcatgcttggtgtccaatcctttggcccgattatcaatcagcctaac
tcggccatcttgggtgtcagtgccactattgagaaacctgttgccctgaacggagaaatt
gtcatccggccgattatgagcctgggactgaccattgaccaccgggtcgtcgacggtatg
gctggagctaagtttatgaaggacctgaaagctttgattgaagatccaatctccatgttg
gtctaa

DBGET integrated database retrieval system