KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_1537Help
Entry
SCR2_1537         CDS       T02834                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
scos00473  D-Alanine metabolism
scos01100  Metabolic pathways
scos01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scos00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCR2_1537 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCR2_1537 (alr)
Enzymes [BR:scos01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SCR2_1537 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:scos01011]
 Precursor biosynthesis
  Racemase
   SCR2_1537 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C HBM TIG
Motif
Other DBs
NCBI-ProteinID: AGU75091
LinkDB All DBs
Position
complement(1560354..1561505)
Genome map
AA seq 383 aa AA seqDB search
MQVILLQLVLFWRNIMKTSNHRPTKAIVDLAAIRFNIKQITAHIPNKVEKWAVVKADAYG
HGAVAVTRCLEPIVDGFCVSNIDEAVELRDASITKKILVLGVSDVSAISLAIERKVTCTV
ASLEWLDLLFQSNIDVAGLIVHIKIDSGMGRIGFRNSQDAQEAIHRLEKAGAQVEGIFTH
FATADEADTQKFEAQLARFKEILGQLETIPPIVHASNSATTLWHSETIMNAVRLGDVIYG
LNPSGTVLELPYDIKPALSLVSELVHVKQLEVGADVGYGATYTSDSPQFIGTIPLGYADG
WTRDMQGFNVLVDGNPCPIVGRVSMDQITVRLPQFYPIGTSVVLIGESGKEAISATDVAE
KRETINYEVVCLISDRVPRVYKE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaatattgttacagctagtgttattttggaggaacatcatgaaaacgagtaat
catcgacctactaaggctattgttgatttagctgctatccgctttaatattaaacaaatt
acagcgcatattccaaataaagtggagaaatgggctgttgtcaaggcggatgcttatggt
cacggtgcagttgctgttacgcggtgtcttgagccaattgtggatggtttttgtgtttct
aatattgatgaagctgtagagttgcgtgatgctagcattacgaaaaaaattctggtatta
ggagtgtcagatgtttctgccatttcattggcaattgagcgcaaagtgacctgtacggta
gctagtttggaatggctagatttgctctttcaatcaaatatagatgtagctggactgatt
gttcatataaaaattgattctggaatggggcggattggttttcgaaatagccaagacgct
caagaagcgattcatcgtttggaaaaggcaggtgctcaggtcgaaggaattttcacccat
tttgcgacagctgatgaagcagatacgcaaaaatttgaggcacagttagcacgttttaaa
gaaattttagggcaattagaaactattccaccgattgttcatgctagtaattcggcaacg
actctgtggcatagtgagacgattatgaatgcagtccgtttgggcgatgtcatttatggg
cttaatccaagtggaactgttttggagctgccttatgacatcaaaccagctctttcattg
gtttcagaattggttcatgtcaagcaattagaagtaggggcagatgtagggtacggagct
acttacactagcgatagcccacagttcattggaacgattccactgggctatgctgatggc
tggacgcgagatatgcaaggctttaatgttttagttgacgggaatccttgtcctattgtt
ggacgcgtatctatggatcagattactgttcgtttacctcagttttatcctattggaacg
tcagttgtccttatcggtgaaagtggtaaagaagctatttctgcaacagatgtggcagaa
aaacgggaaaccatcaattacgaggtggtttgtttgatcagcgaccgcgtccctagagtt
tacaaagaatga

DBGET integrated database retrieval system