KEGG   Sorangium cellulosum So0157-2: SCE1572_30910Help
Entry
SCE1572_30910     CDS       T02718                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
scu  Sorangium cellulosum So0157-2
Brite
Enzymes [BR:scu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SCE1572_30910
Peptidases [BR:scu01002]
 Metallo Peptidases
  Family M2
   SCE1572_30910
Exosome [BR:scu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCE1572_30910
CD molecules [BR:scu04090]
 Proteins
  SCE1572_30910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8773156..8775087)
Genome map
AA seq 643 aa AA seqDB search
MLVALGLGSACSGAASPAPAPPAPGGEAPAPPAAPAAPRPQAALPAEAPPSVAEAQAFLA
GVDRDLRRLRLQSARAGWVNQTFLTDDTDALAASADEASMEYLNRTMKAARRFDGLALPA
DLARQLKLLKISTTLPAPSDPAERAELAALSVEMTSLYGKGKYCPEGKAARPAPAGAAAA
AGAPPAQKCLALDDLSEIMKTSRKWDELLDAWTGWHTIAPPLRPKFERFVSLGNKGAAEV
GFADLGALWRAGYDMPPEAFEADTERLWGQLKPLYDELHCYVRARLRATYGKDRIGDKAP
IPAHLLGNMWAQGWSNVYGLMEPYKGQPSLDVTRKIKAKKLDEKQMVALGERFFTSLGLD
PLPATFWERSLFKKPTDREVVCHASAWDVGHRNDLRIKMCIRPNEEDLITIHHELGHIYY
YSQYYKLPILFQEGANDGFHEGIGDTLALSVTPSYLKTLGLVDRVPEDEKGLINFLLKTA
LDKVAFLPFGKLIDQWRWDVFSGKTKPADYNKAWWALRLKYQGVAPPVPRSEADFDPGAK
FHVPANVPYTRYFLAHIYQFQFHRALCKAAGHTGPLHACSIYGSAAAGEKLRAMLSLGAS
RPWQEAMKAMTGETDADPSAMLEYFEPLRRWLKEQNKGEVCGW
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgcgctcgggctcgggtcggcctgcagcggcgccgcgtcgccggcgcccgcg
ccgccggcccccggcggggaggcgcccgcgcccccggcggcgcccgcggccccccggccc
caggccgccctcccggcggaggcgccgcccagcgtggccgaggcgcaggccttcctggcc
ggcgtcgaccgggatctgcgcaggctgcggctccagtccgcgcgcgcggggtgggtgaac
cagaccttcctcacggacgacacggacgcgctcgccgcctccgccgacgaggcgagcatg
gagtacctcaaccgcacgatgaaggcggcgaggcgcttcgacggcctcgcgctgcccgcg
gatctcgcccgccagctgaagctcctcaagatctcgaccaccctgccggccccgagcgac
ccggcggagcgcgcggagctcgccgcgctctcggtcgagatgacgagcctctacggcaag
ggcaagtactgcccggagggcaaggcggcgcggcctgccccggccggcgccgctgcggcg
gcgggggctccgccggcgcagaaatgtctcgcgctggacgatctctccgagatcatgaag
accagccgcaaatgggatgagctgctcgacgcgtggacgggctggcacacgatcgcgccg
ccgctccggccgaagttcgagcggttcgtcagcctcggcaacaagggggccgcggaggtc
ggcttcgcggacctcggcgcgctctggcgggccgggtacgacatgccgcccgaggcgttc
gaggccgacaccgagcggctctggggtcagctgaagccgctctacgacgagctgcactgc
tacgtgcgcgcccggctgcgcgcgacgtacggcaaggacaggatcggcgacaaggctccg
atccctgcgcacctgctcggcaacatgtgggcccaggggtggtcgaacgtctacgggctc
atggagccgtacaagggccagccgtcgctcgacgtgacgcgcaagatcaaggcgaagaag
ctcgacgagaagcagatggtcgcgctcggcgagcggttcttcacctcgctcgggctcgac
ccgctgccggccacgttctgggagcggtcgctcttcaagaagcccaccgaccgcgaggtc
gtctgccacgcgagcgcctgggacgtcggccacaggaacgacctccgcatcaagatgtgc
atccggccgaacgaggaggatctcatcacgatccaccacgagctcgggcacatctattac
tatagccagtactacaagctgccgattctgttccaggagggcgccaacgacggcttccac
gaggggatcggggacacgctggccctctccgtgacgccgagctatctgaagacgctgggg
ctcgtcgacagggtgccggaggacgagaaggggctcatcaacttcctcttgaagacggcg
ctcgacaaggtcgcgttcctcccgttcggcaagctcatcgatcagtggcggtgggacgtc
ttctcgggcaagacgaagccggccgactacaacaaggcgtggtgggcgctccggctcaag
taccagggcgtcgcgccgcccgtgccgcgcagcgaggccgacttcgacccgggggcgaag
ttccacgtcccggcgaatgtcccctacacgcggtatttcctcgcgcacatctaccagttc
cagttccaccgcgcgctctgcaaggcggccgggcacacggggccgctccacgcgtgctcg
atctacggcagcgcggccgcgggcgagaagctgcgcgccatgctgtcgctcggcgcgagc
cggccgtggcaggaggcgatgaaggcgatgacgggggagacagatgccgatccgagcgcg
atgctggagtacttcgagccgctccggaggtggctcaaggagcagaacaagggtgaagtc
tgtgggtggtaa

DBGET integrated database retrieval system