KEGG   Streptomyces sp. CdTB01: AS200_31520Help
Entry
AS200_31520       CDS       T04240                                 

Definition
(GenBank) alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
scx  Streptomyces sp. CdTB01
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AS200_31520
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AS200_31520
Enzymes [BR:scx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AS200_31520
Bacterial toxins [BR:scx02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AS200_31520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7081751..7082824
Genome map
AA seq 357 aa AA seqDB search
MTEASVPFRAGREGYASYRIPAVVATPGGTLLAFCEGRVTSASDHGRIDVVLKSSADGGR
TWSPLRVAAANGTGLAGNPAPVVLDTGRVLLVHVRAAATATEELIRLGKAKDADGRRVWV
QHSDDDGVTWSEPAEITASVKRPDWRWYATTPGHALQLSTGRVVVPANHSLPPAGTDLGT
EAKYNGGHCLLSDDRGETWSIGYVDDNTDGYINVNETTAAELPDGSVYFNTRNDSPSPGN
RADARSEDGGETLRTPFRPQAGLTGPVCEGSLLQLRDPDVLLFSGPAHPDARALMTVRAS
VNDGTTWRPVYTMDGLPAAYSDLVRIDDSTVGILYETGDFGAYERIVLRRLPVTRLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctccgtcccgttccgcgccggccgcgagggatacgccagttaccgcatc
cccgcggtggtcgccacccccggcggcaccctgctcgccttctgcgagggccgggtgacc
tccgcgagcgaccacggccgcatcgacgtcgtgctcaagagctcggcggacggcggccgc
acctggagcccgctcagagtggccgcggccaacggcaccggcctcgccggcaaccccgcc
ccggtggtcctcgacaccggccgcgtcctcctcgtccacgtccgcgccgccgccacggcc
accgaggaactcatccggctgggcaaggcgaaggacgccgacggccgccgcgtgtgggtg
cagcacagtgacgacgacggcgtcacctggtcggagccggccgagatcaccgcgtcggtg
aagcggccggactggcgctggtacgccaccacccccggccacgccctccagctgagcacc
ggccgcgtcgtcgtccccgccaaccacagccttccgcccgccggcaccgacctcggcacc
gaggcgaagtacaacggcggccactgcctgctcagcgacgaccgcggcgagacctggtcg
atcggctacgtcgacgacaacaccgacggctacatcaacgtcaacgagaccaccgccgcc
gaactccccgacggcagcgtctacttcaacacccgcaacgactccccgtcccccggcaac
cgcgccgacgcccgctccgaggacggcggtgagaccctgcgcacccccttccgcccgcag
gccggcctgaccggcccggtgtgcgagggcagcctgctccagctccgcgacccggacgtg
ctgctcttctccggccccgcccaccccgacgcgcgcgccctgatgaccgtccgcgcctcc
gtgaacgacggcaccacctggcggccggtgtacaccatggacggcctgcccgccgcctac
tccgacctcgtccggatcgacgactcgaccgtcgggatcctctatgagacgggggacttc
ggcgcctacgagcggatcgtcctgcggcggctgccggtgacgcggctcacctga

DBGET integrated database retrieval system