KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_33190Help
Entry
SCATT_33190       CDS       T02095                                 

Definition
(GenBank) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCATT_33190
Enzymes [BR:scy01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SCATT_33190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3516706..3517917
Genome map
AA seq 403 aa AA seqDB search
MSETTTPATAAALDDRAAALDAADPLAALRERFVLDDTVYLDGNSLGALPKNVAGRLAEV
VEDEWGRLRIRSWDESGWWTAPERVGERIAPLVGAAPGQIVVGDSTSVNVFKAVVAATRL
AGPGRDEVLVDAATFPTDGYVAASAARLTGHTVRPVAAGEMAAAAGARTAALLVNHVDYR
TGELADLPGITAAAHAAGAVAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGAPA
FLYLARRIQDRFDSPLPGWNSHTDPFAMRPGYEAAPGAVRGRVGTPEILSLLALEAALEV
WEGVDVAQVRAKSLALTDFFLECVAALVPDGRLEPVTPAEHARRGSQVSLRCADAGAVMA
ALIERGVVGDFRRPDVLRFGFTPLYTGFADVLRAARVLADTVR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacgacgaccccggccaccgccgccgccctcgacgaccgggccgccgcgctc
gacgccgccgacccgctggccgcgctgcgcgagcgcttcgtcctcgacgacaccgtctac
ctggacggcaactccctcggcgcgctgccgaagaacgtggccggccgcctcgccgaggtg
gtggaggacgagtggggccggctgcggatccgttcgtgggacgagagcggctggtggacg
gcgccggaacgggtcggcgagcggatcgcgccgctggtcggcgccgcccccgggcagatc
gtggtgggcgactccaccagcgtcaacgtcttcaaggcggtcgtcgccgcgacccggctg
gccggccccgggcgcgacgaggtgctggtggacgcggccaccttccccaccgacggctac
gtcgccgcgtcggcggcccggctgaccgggcacacggtacgcccggtggccgccggggag
atggccgcggcggccggggcgcgcaccgcggcgctcctggtcaaccacgtcgactaccgc
accggggaactcgccgacctgcccggcatcacggccgccgcgcacgccgccggggcggtc
gcggtgtgggacctgtgccacagcgcgggcgccctgccggtcgggctggacgagcacggg
gtggacctggcggtcggctgcacctacaagtacctcaacggcggcccgggcgcgcccgcg
ttcctctacctggcgcggcggatccaggaccgtttcgactcgccgctgcccggctggaac
tcgcacaccgacccgttcgccatgcgccccgggtacgaggccgcccccggcgcggtacgc
ggccgggtggggaccccggagatcctctcgctgctcgctctggaggcggcgctggaggtg
tgggagggggtggacgtcgcccaggtgcgcgccaaaagcctggcgctgaccgacttcttc
ctggagtgcgtggccgccctggtgccggacggacggctggagccggtgaccccggccgag
cacgcccggcgcggcagtcaggtctcgttgcgctgcgcggacgccggcgcggtgatggcg
gcgctgatcgagcggggggtggtcggcgacttccggcggccggacgtgctgcggttcggt
ttcaccccgctgtacacgggcttcgccgacgtgctgcgggcggcccgcgtcctcgcggac
accgtgcggtga

DBGET integrated database retrieval system