KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_36580Help
Entry
SCATT_36580       CDS       T02095                                 

Definition
(GenBank) glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00564  Glycerophospholipid metabolism
scy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCATT_36580
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCATT_36580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEW96029
UniProt: F8JZE7
LinkDB All DBs
Position
3935267..3936973
Genome map
AA seq 568 aa AA seqDB search
MRTAPLGPQQRTQALARMAEQELDVLVVGGGVVGAGTALDSVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLQRLAPHLVHPVPFLYPLTRRGWERLY
AGSGVALYDTMAFSSGHGRGLPHHRHLTRRHALRVAPCLRKDALVGALQYYDGQVDDARF
VTTLVRTAASYGAQTANRARVVGFLREGERVVGARVLDAEQGGEYEVRARQVVNATGVWT
DETQALVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWNLDKAHPAASSADIDYLLEHVNSVLAVPLTRDDVEGVYAGLRPLLAGESEATSQLSR
EHTVAHAAPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDGRVAACCTEDVPLAGAVGYPAL
WNARARLAARAGLHVARVEHLLNRYGSLVDEVLELIAADASLGEPLTGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCARQAAELMAPVLGWDGERTRREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacggcaccactgggcccgcagcagcgcacccaggcgctggcgcggatggccgaa
caggaactggacgtactggtggtcgggggcggggtggtcggtgccggtacggcgctggac
tcggtgacccgggggctgtcgacggggctggtcgaggcgcgggactgggcctcgggtacc
tccagcaggtcgagcaagctcatccacggcggcctgcgctacctggagatgctggacttc
gcgctggtccgcgaggcgctgaaggaacgcggcctgctgctccagcggctcgccccgcac
ctggtgcacccggtgccgttcctgtatccgctcacccgccgcggctgggagcggctgtac
gccggctccggggtcgcgctctacgacaccatggcgttctcctccgggcacggccgcggg
ctgccgcaccaccgccatctgacccgccgccacgcgctgcgggtggcgccctgtctgcgc
aaggacgcgctggtcggcgcgttgcagtactacgacggccaggtggacgacgcccgtttc
gtcaccaccttggtgcggaccgcggcctcctacggcgcgcagacggccaaccgggcgcgg
gtcgtcggcttcctgcgcgagggggaacgggtggtcggcgcccgggtgctcgacgccgag
cagggcggggagtacgaggtgcgggcgcggcaggtggtcaacgccaccggggtgtggacg
gacgagacgcaggcgctggtcggcgagcgcggccagttccacgtccgggcgtccaagggg
atccacctggtggtgcccaaggaccgtatccactccaccaccgggctcatcctgcgcacc
gagaagagcgtgctcttcgtgatcccgtggggccggcactggatcgtcggcaccaccgac
accgactggaacctggacaaggcccacccggcggcctccagcgccgacatcgactacctg
ctggagcacgtcaactcggtgctggcggtgccgttgacccgggacgacgtggagggcgtc
tacgccgggctgcggccgttgctggccggcgagtcggaggccaccagccagctctcccgg
gagcacacggtggcccacgccgcgcccggcctggtggtcgtggcgggcggcaagtacacc
acgtaccgggtgatggccaaggacgcggtggacgcggcggtgcacgggctggacggccgg
gtcgccgcgtgctgcaccgaggacgtcccgctggccggggcggtggggtatccggcgctg
tggaacgcccgggcccgcctcgccgcgcgcgccgggctccacgtggcccgggtcgaacac
ctgctgaaccggtacggttcactcgtcgacgaggtgctcgaactgatcgcggccgacgcc
tcgttgggcgagccgctcaccggcgccgaggactatctgcgggccgaggtggtctacgcc
gcctcccacgagggcgcccgccacctcgacgacgtgctcacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccggtgcgcccggcaggcggcggagttgatggccccg
gtgctcggctgggacggtgaacgtacacgaagagaagtcgaacattacgagaaacgggtc
gaggcggaacgggaatcgcaacggcagccggacgatctgaccgcggacgcggccaggttg
ggggcgccggatatcgttccgcattga

DBGET integrated database retrieval system