KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_54560Help
Entry
SCATT_54560       CDS       T02095                                 

Definition
(GenBank) DNA polymerase LigD ligase subunit
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5865934..5866917
Genome map
AA seq 327 aa AA seqDB search
MDAAHHRRPRPDDPVPDRVTPMLAVLSDRRHFDDTWVLERKLDGVRAIGFRDGDTVRLAS
RTGQRLENTYPEIVRALADQPQRAFVVDGEIVALDDGRTSFERLQRRMQLTRPSAALASG
VAVTYFLFDLLHLAGHDTTGLPLRSRKELLREAVRYTGPLRYTEHHTATGDAGQLLDAAC
AQGWEGLIAKRADGRYQQRRSSDWLKLKCLTAQEFVVGGYTEPAGSRAGFGALLLGYHQG
GRLRYAGKVGTGYDTATLRRLRGLLDERGLTEPPFAEPVRERGAHWVRPDLVVQVAFTEW
TRDGRLRAPRYLGLRQDKRPERVVREG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgcacaccaccgcaggccacgaccggacgacccggtgccggaccgggtcacc
ccgatgctcgccgtgctctccgaccgccgccacttcgacgacacctgggtgctggagcgc
aaactcgacggcgtccgggcgatcggcttccgggacggcgacaccgtacgcctggcctcc
cgcaccgggcagcgcctggagaacacctacccggagatcgtgcgggcgctggccgaccag
ccgcagcgggccttcgtggtggacggcgagatcgtggcgctggacgacggacgcaccagc
ttcgaacggctccagcgccgcatgcagctcacccgcccgtccgccgcgctcgccagcggg
gtggccgtcacctacttcctgttcgacctgctgcacctggccggacacgacaccaccggg
ctgccgctgcgctcccgcaaggaactgctgcgcgaggcggtccgctacaccggcccgctg
cgctacaccgaacaccacaccgccaccggtgacgccgggcagctcctggacgccgcctgc
gcccaggggtgggaggggctgatcgccaaacgcgccgacggccgctaccagcagcgccgc
tcctccgactggctcaagctcaaatgcctcaccgcccaggagttcgtcgtcggcggctac
accgagccggccggcagccgcgccggcttcggcgccctgctgctcggctatcaccagggc
ggacggctgcggtacgcgggcaaggtgggcaccgggtacgacaccgcgacgctgcggcgg
ctgcgcgggctgctggacgaacgcgggctgacggagccgccgttcgccgaaccggtccgg
gaacgcggcgcgcactgggtccgccccgacctcgtggtgcaggtggcgttcaccgagtgg
acccgggacggcagactgcgggccccgcgctacctggggttgcggcaggacaagcggccg
gagcgggtggtgcgggaggggtga

DBGET integrated database retrieval system