KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_54580Help
Entry
SCATT_54580       CDS       T02095                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:scy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SCATT_54580
Enzymes [BR:scy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCATT_54580
DNA repair and recombination proteins [BR:scy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCATT_54580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5867979..5868884
Genome map
AA seq 301 aa AA seqDB search
MPPMPDRQAVEVDGHRLVLVNLDRLLFPVSGHTKAQLLHYYAQVAEVLLPHATGRPASFV
RAPDGPGGQTWYAKRPPPGLPDWVTLAEVPGSEGPAPHVVVDSTAALMAMANLAAFEVHV
PQWTARTGPDGHDRLVLDLDPGPGADLVLCCTVAQRLRQMLADDGLTAYPVSSGSKGLHL
YAPLEPAPERAVSGYARSLAQRMQAEHPGLVTASMDRSIRPGKVFIDWSQNATHKTTACP
YTLRLHERPRVAAPVGWDEIAGCAAPERLVLSPEQVVERVARLGDPLAELAARTHAAPLP
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccatgcccgaccggcaggccgtggaggtggacggccaccgcctggtcctcgtc
aacctcgaccggctgctcttcccggtctcgggtcacaccaaggcccagctgctgcactac
tacgcgcaggtggccgaggtgctgctgccgcacgccaccggccgtcccgcctccttcgta
cgcgctccggacggccccggcgggcagacctggtacgccaaacggcccccgccgggactg
cccgactgggtgacgctggccgaggtgcccggcagcgaggggcccgccccgcacgtggtg
gtcgactccaccgccgcgctgatggcgatggccaacctcgccgcgttcgaggtgcacgta
ccgcagtggaccgcccggaccggcccggacggccacgaccggctcgtcctcgacctcgac
cccggccccggcgccgacctggtgctttgctgcaccgtggcgcagcggctgcggcagatg
ctcgccgacgacgggctgaccgcctatccggtctcctccggttccaagggcctccatctg
tacgcgccgctggagcccgccccggaacgcgcggtctccggctacgcccggtcgctggcc
cagcggatgcaggcggagcacccggggctggtgaccgcctccatggaccgctcgatccgg
cccggcaaggtcttcatcgactggtcgcagaacgccacccacaagaccaccgcctgcccc
tacaccctgcgcctgcacgaacgcccgagggtggccgcaccggtcggctgggacgagatc
gccggctgcgccgccccggaacggctggtgctctccccggagcaggtggtcgaacgggtg
gccaggctcggcgatccgctggcggaactggccgcccgcacccacgcggcgccgttgccg
cggtga

DBGET integrated database retrieval system