KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_55160Help
Entry
SCATT_55160       CDS       T02095                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5927486..5928553)
Genome map
AA seq 355 aa AA seqDB search
MMPPVKPMLARLAATIPPGMSYEAKWDGFRAIVFRDGDEVELGSRTAKPLTRYFPEVVEA
VRANVPGRCVLDGEIVIARGGRLDFDALLERIHPAKSRVELLSRRTPASFVAFDILALGD
RSLMAAAQRDRRALLAEALAGAVHPVHIAPATTDLALAEEWFSRYEGAGLDGVVAKPLDL
PYRPDERVMVKVKHERTADCVVAGFRYHKSGPVVGSLLLGLHDAAGGLRHVGVTSAFPMA
RRKALLTELEPLRMASFEGHPWAHWADPEAHTTDRMPGAPSRWSGKKDLSWIPLRPERVC
EVAYDHMQGDRFRHTAQFRRWRPDRDPGDCTYAQLAEPVRYELADVLPPRAADAI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatgccgccggtcaagccgatgctggccaggctcgcggcgacgattccgcccgggatg
agctacgaggccaagtgggacgggttccgggcgatcgtcttccgcgacggcgacgaggtg
gaactcggcagccgtaccgccaagccgctcacccgctacttccccgaggtggtggaggcg
gtgcgggccaacgtccccgggcggtgcgtgctggacggtgagatcgtgatcgcgcgcggc
gggcggctggacttcgacgcgctgctggaacgcatccatccggcgaagtcccgggtggag
ctgctgtcccgccggaccccggcctccttcgtggccttcgacatcctggcgctcggggac
cggtcgctgatggccgccgcgcagcgcgaccgccgcgcgctgctggccgaggcgctggcc
ggtgccgtccacccggtgcacatcgccccggccaccacggacctggcgctggccgaggag
tggttcagccgttacgagggggccgggctggacggggtggtcgccaagccgctggatctg
ccgtaccggccggacgagcgggtgatggtcaaggtcaagcacgagcggaccgccgactgc
gtggtggccggcttccggtaccacaagagcggcccggtggtcggctcgctgctgctcggg
ctccacgacgcggcgggcgggctgcgccacgtgggcgtcacctcggcgttcccgatggcc
cgccgcaaggcgctgctgaccgagctggagccgttgcgcatggcgtccttcgagggccat
ccgtgggcgcactgggccgaccccgaggcgcacaccaccgatcggatgccgggggcgccg
agccggtggagcggcaagaaggacctgtcgtggatcccgttgcgtccggagcgggtctgc
gaggtggcctacgaccacatgcagggcgaccggttccggcacaccgcgcagttccgccgt
tggcgccccgaccgcgaccccggtgactgcacctacgcgcagttggcggagccggtgcgc
tacgagctggcggacgtgctgccgccccgggccgccgacgcgatctga

DBGET integrated database retrieval system