KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_55170Help
Entry
SCATT_55170       CDS       T02095                                 

Definition
(GenBank) hypothetical protein
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5928642..5929649
Genome map
AA seq 335 aa AA seqDB search
MAEAVELRAGERTVRVSHPDKVYFPERGLTKLDVVRYYLAVGDGVLRALRDRPTMLERYP
DGVGGESFFQKRAPKNLPEWIPTGRIAFPSGRYADEICPTETAAVLWAANLGCLTFHPWP
VRRADVDHPDELRIDLDPQPGTGFPEARRAARELRPLLTELGLTGWPKTSGGRGLHVFVP
IEPRWTFTQVRRAAIAVARELERRMPEQVTTAWWKEERGAKIFVDYNQTARDRTIASAYS
VRPRPHAPVSAPLRWEEVDDADPRDFDVVTMAARFAELGDVHAPMADRPCSLLSALELAD
RDERDHGLGDLPYPPEHPKMPGEPARVQPSRAKRR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcggtggagttgcgagcgggggagcgcacggtacgtgtctcccaccccgac
aaggtgtacttcccggaacgcgggctgaccaagctcgacgtggtgcgctactacctcgcg
gtcggcgacggcgtgctgcgcgccctgcgcgaccgccccaccatgctggagcgttacccc
gacggggtgggcggcgagtcgttcttccagaagcgcgcccccaagaacctgccggagtgg
atccccaccggccggatcgccttccccagcggccggtacgccgacgagatctgccccacc
gagaccgccgccgtgctgtgggccgccaacctcggctgcctgaccttccacccctggccg
gtacggcgggcggacgtcgaccacccggacgaactgcgcatcgacctcgacccgcagccc
ggcaccggcttccccgaggcccggcgggccgcccgggaactgcgcccgctcctgaccgaa
ctggggctcaccggctggcccaagacctcgggcggccgtggcctgcacgtcttcgtcccc
atcgaaccgcgctggaccttcacgcaggtgcgccgggccgccatcgccgtcgcccgcgaa
ctcgaacgccgcatgcccgagcaggtgaccaccgcctggtggaaggaggaacgcggcgcc
aagatcttcgtcgactacaaccagaccgcccgggaccgcaccatcgcctccgcctactcg
gtgcgcccccggccgcacgccccggtctccgcgccgctgcgctgggaggaagtggacgac
gccgacccgcgcgacttcgacgtggtcaccatggccgcccgcttcgccgaactcggcgac
gtgcacgcgccgatggccgaccggccgtgctcgctgctgagcgcgctggaactcgccgac
cgcgacgaacgcgaccacggcctcggcgacctgccctacccgcccgagcaccccaagatg
ccgggggagccggcccgggtgcagcccagccgggccaagcgccgctga

DBGET integrated database retrieval system