KEGG   Streptomyces sp. CFMR 7: ABE83_05060Help
Entry
ABE83_05060       CDS       T04074                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00020  Citrate cycle (TCA cycle)
scz00480  Glutathione metabolism
scz01100  Metabolic pathways
scz01110  Biosynthesis of secondary metabolites
scz01120  Microbial metabolism in diverse environments
scz01130  Biosynthesis of antibiotics
scz01200  Carbon metabolism
scz01210  2-Oxocarboxylic acid metabolism
scz01230  Biosynthesis of amino acids
Module
scz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:scz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE83_05060
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABE83_05060
Enzymes [BR:scz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABE83_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: ALC26520
UniProt: A0A0M4E224
LinkDB All DBs
Position
complement(1304117..1306339)
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSLLPVIEAYASTAGVTVERRDISLAGRIIASFPEHLKAEQ
RIDDALAELGELARTPGANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPQTDAEK
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGVDD
FRSTEKSAVIAEDGSLRIELHGDDGTTTVLRESVPVLKGEVVDAAVMRVAALREFFTAQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHAVRAFFPNTFAKYGDQLAAAGLTPNDGLGGI
LKGLDSLPGVGAEIQASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSG
HMWGPDGNEADTIAVLPDSSYAGVYQVVIDDCRANGAFDPATMGSVPNVGLMAQKAEEYG
SHDKTFEIAATGTVRVVDTDGNVVLEQAVGAGDIFRMCQTKDAPIQDWVKLAVTRARATG
TPAVFWLDEGRAHDANLIAKVTTYLADHDTDGLDISIKSPEEATAFSLERIRRGEDTISV
TGNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRW
DSLGEFLALAVSFEHLATTTDNARAQVLADTLDRATGTFLNEDKSPSRRLGGIDNRGSHF
YLALYWAQELAQQTDDAKLAEAFAPLAKTLAEQEETIVAELIAVQGSPAEIGGYYQPDPA
KAAAVMRPSATFNQAIASLA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggcgacctat
tccctcctgcccgtgatcgaggcctacgcctcgaccgccggggtcacggtggagcgccgt
gacatctccctcgcggggcggatcatcgccagtttcccggagcacctcaaggccgagcag
cgtatcgatgacgcactcgccgagctgggcgagctggccaggactcccggcgcgaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggcggccatcgcggagctc
caggggcagggctacgcgcttccggactacccggacgacccgcagaccgacgcggagaag
gacatccgcgcccggtacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctccgtcaagaactacgccaaggcccacccgcac
cgcatgggcgcctggacggccgactcgaagacgaacgtcgccaccatgggcgtcgacgac
ttccgctccaccgagaagtccgcggtcatcgccgaggacggctcgctccgcatcgagctg
cacggcgacgacggcaccaccaccgtgctccgcgagtccgtacccgtcctcaagggcgag
gtcgtggacgcggccgtcatgcgcgtcgccgcgctgcgcgagttcttcaccgcgcaggtc
gcccgcgccaaggccgagggcgtgctcttctccgtgcacctcaaggccaccatgatgaag
gtctccgacccgatcatcttcggccacgcggtccgcgccttcttcccgaacaccttcgcc
aagtacggcgaccagctcgccgccgcgggcctcacccccaacgacggtctgggcggcatc
ctcaagggcctcgactcgctgccgggcgtcggcgccgagatccaggcgtccttcgaggcc
gagctggccgagggccccgccctcgcgatggtcgactcggacaagggcatcaccaacctc
cacgtccccagcgacgtcatcgtcgacgcctccatgccggccatgatccgcacctccggc
cacatgtggggcccggacggcaacgaggccgacaccatcgccgtcctcccggacagcagc
tacgccggtgtctaccaggtcgtcatcgacgactgccgcgccaatggcgccttcgacccc
gccaccatgggctccgtgcccaacgtcggtctgatggcgcagaaggccgaggagtacggc
agccacgacaagaccttcgagatcgccgccaccggcaccgtccgcgtcgtcgacacggac
ggcaacgtcgtgctggagcaggccgtcggcgccggtgacatcttccggatgtgccagacc
aaggacgcgccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggc
accccggccgtcttctggctggacgagggccgcgcccacgacgccaacctgatcgccaag
gtcaccacgtacctggccgaccacgacacggacggcctggacatctcgatcaagtcgccg
gaggaggccaccgccttctccctggagcgcatccgccgcggcgaggacaccatctccgtc
accggcaacgtgctccgtgactacctgacggacctcttcccgatcctggagctgggcacc
agcgccaagatgctctccgtcgtcccgctgatgaacggcggcggcctcttcgagaccggc
gccggcggctcggcccccaagcacgtccagcagctcgtcaaggagaactacctccgctgg
gacagcctgggcgagttcctggccctcgcggtcagcttcgagcacctggccaccaccacg
gacaacgcgcgggcccaggtcctcgcggacaccctggaccgggcgaccggcaccttcctc
aacgaggacaagtccccgagccgccgcctcggcggcatcgacaaccgcggcagccacttc
tacctggctctctactgggcccaggagctggcgcagcagaccgacgacgccaagctcgcg
gaggccttcgccccgctcgccaagaccctggccgagcaggaggagaccatcgtcgccgag
ctgatcgcggtgcagggctccccggccgagatcggcggctactaccagcccgacccggcc
aaggccgccgccgtcatgcgcccgtccgccacgttcaaccaggcgatcgcgagcctcgcc
tga

DBGET integrated database retrieval system