KEGG   Streptomyces sp. CFMR 7: ABE83_19660Help
Entry
ABE83_19660       CDS       T04074                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scz00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    ABE83_19660
Enzymes [BR:scz01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     ABE83_19660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4671378..4672601
Genome map
AA seq 407 aa AA seqDB search
MSETSRETFRERALKLDAADPLADRRKLFALDDGVYLDGNSLGALPVHVPARVQDVLTRQ
WGELRIRSWGESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKAVVAATRLAALA
GGGRDEILVDATTFPTDGYIAASAARLTGHRIVPVDPADVPAALGDRTAAVLLNQVDFRT
GRLHDLPALTAAVHAAGAIAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAY
LYVAERHQAAFDSPLPGWNSHADPFGMTPDYTPADGSVRGRVGTPDIVSMLTLEAALDVW
DGVSVDAVRAKSLALTDFFLECVEAYVPAGRVASVTPVAHAERGSQVALRCDEAEPVMSR
LIERGVVGDLRRPDVLRFGFTPLYVGFADAERAARVLAEVLEEIPAG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacctctcgtgagacgttccgtgagcgggcgctgaagctcgacgccgccgac
ccgctggccgaccgccggaagctcttcgcgctcgacgacggcgtctacctcgacggcaac
tcgctcggcgcgctccccgtccacgtccccgcccgggtgcaggacgtcctcacccgccag
tggggcgagctgcgcatccggtcctggggcgagagcggctggtggaccgcgcccgagcgg
atcggggaccggatcgccccgctcgtcggggccgccgccggacagatcgtcgtcggtgac
tcgaccagcgtgaacgtcttcaaggccgtcgtcgcggccacccgcctcgccgccctcgcg
ggcgggggacgcgacgagatcctggttgacgccacgacgtttcccacggacgggtacatc
gccgcctccgccgcccggctgaccggccaccggatcgtgccggtcgaccccgccgacgta
ccggcggctctcggggaccgtacggccgccgtcctcctcaaccaggtggacttccgtacg
ggacggctccacgacctgcccgccctgaccgccgccgtccacgcggcgggcgcgatcgcg
gtgtgggacctctgccacagcgcgggggccctgccggtcggtctggacgagcacggggtg
gacctggccgtcggctgcacctacaagtacctgaacggcggccccggttcgcccgcgtac
ctgtacgtggccgagcgccaccaggccgccttcgactccccgctgccggggtggaactcg
cacgccgacccgttcggcatgacccccgactacaccccggcggacggttccgtacggggc
cgggtcggcacgcccgacatcgtctccatgctcacgctggaagcggcgctggacgtgtgg
gacggggtctcggtggacgccgtccgcgccaagtccctggccctgacggacttcttcctg
gagtgcgtcgaggcgtacgtaccggcgggccgggtcgcctcggtcaccccggtcgcgcac
gccgagcgcggcagccaggtcgccctgcgctgcgacgaggccgagcccgtgatgagccgc
ctcatcgagcgcggtgtggtgggcgatctgcggcggccggacgtgctgcggttcggtttc
accccgctgtacgtggggttcgcggacgcggaacgggcggcgcgggtcctggccgaggtg
ctggaggagatcccggcgggctga

DBGET integrated database retrieval system