KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0338Help
Entry
SDSE_0338         CDS       T02333                                 

Gene name
amyE
Definition
(GenBank) alpha-amylase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDSE_0338 (amyE)
Enzymes [BR:sdc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDSE_0338 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
300830..302203
Genome map
AA seq 457 aa AA seqDB search
MVSSRRKKITVASLVTGVMLGTAGLGWFWSQHTQKVEMKDGAILHAWCWSFDTIKDNLPA
IKKAGYTSIQTSPINQVVEGENGSKALTNWYYHYQPTDYTIGNYQLGTEADFKALTKEAD
KYGLHIIVDAVVNHTTSDVAAVSPKIKALGKWTHGNEGIKDFGDRYQLTQKSLLGLYDLN
TQNKAVQEYLLAYLKRAVADGADGFRYDAAKHIELPKEYGSDFWSVILNNGAQFQYGEIL
QGSTSKEADYAKLMGVTASDYGEFIRNSLRQEEAYAEDLMDFQAPGVPEDRLVTWVETHD
TYANDNGESTNLTDQDIILGWSLIASRKEGAPLFYSRPVGGGGQNDRFPGQSEIGDAGSD
LFKNKTIVAINHFRNTMNGRDEYLHNIGDDQGLVMVERGGKGAIITNLASENKTFSTSTK
LADGSYKDAVSGKIYKVSGKILKGKLPKKSVLVLLPA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctcaagacgaaagaaaataacagtcgcctcgctagtaacaggggtaatgttg
gggacggctggtttaggttggttttggtcacagcatacccaaaaggttgaaatgaaagat
ggcgccattctgcatgcatggtgttggtcttttgataccattaaagataatttaccagct
attaagaaagctggttataccagcattcaaacgtctcctattaatcaagttgttgagggg
gaaaatggtagtaaggcattaacgaattggtattatcattatcaaccgacagattataca
atcggcaactatcagttgggaacggaagcagactttaaagctttgaccaaagaggctgat
aagtatggtcttcatattattgtggatgcggtggttaatcataccacttcagatgtagca
gctgttagtcctaagataaaagctttagggaaatggactcatggaaatgaaggcattaaa
gattttggtgatcgctatcaactgactcaaaagtccctgttgggactatatgatcttaat
actcaaaataaagctgttcaagaatatcttcttgcttatctcaaacgtgcagtagcagat
ggtgcggatggatttaggtatgatgcagcaaaacatatcgaattgcccaaagagtatggc
agtgatttttggtcagttatcttgaacaatggcgctcaattccagtatggggaaatttta
cagggctctacttctaaagaagctgactatgctaagttaatgggagttacagcatcagat
tatggtgaatttattcgaaacagtttacggcaggaagaagcctacgcggaagacctgatg
gattttcaggcaccaggagttccagaagaccgactcgtcacatgggtggaaacacatgac
acctatgccaatgataatggggaatcaactaatttgacagaccaagacatcattttaggc
tggagtttgattgcctctcgaaaagagggagcacctctcttttattctcgtccggtaggg
ggtggtggtcaaaatgatcgtttcccaggccaatctgaaattggagatgcaggcagtgac
ctatttaaaaataaaaccattgtggccatcaatcattttagaaatacgatgaatggacgt
gacgaataccttcataatattggtgacgatcaagggcttgtaatggtagagagaggtggt
aaaggagctattattaccaatttagcaagtgagaataagaccttttcaacgtcaacaaaa
ttggctgacggtagttacaaagatgcagtaagcggaaaaatttacaaggtatcaggaaaa
attctcaaaggcaagctgcctaaaaaatcagtcttggtgttgcttccagcataa

DBGET integrated database retrieval system