KEGG   Steroidobacter denitrificans: ACG33_12150Help
Entry
ACG33_12150       CDS       T04296                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sdf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACG33_12150
Enzymes [BR:sdf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACG33_12150
Transporters [BR:sdf02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACG33_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AMN47836
UniProt: A0A127FBP5
LinkDB All DBs
Position
complement(2688726..2689337)
Genome map
AA seq 203 aa AA seqDB search
MKLYYSRGACSLAAHIALYEAGLAFRAEPVDLKAKTLAGGADFRQVNPLGYVPVLELDGG
ERLTEVGVVLQYIADQKPETSLAPPAGTMPRYRLMQWLAFISSELHKTFSPLFAPHTPED
YKPVIRERLAQRLAYMNQQLAASSFLMGEQFTVADAYLFVVLNWAGVMNLDLTPYAHLQS
FQKRVGARPGVQRALQAEGLLGS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattacagtcgcggtgcttgctccctggcggctcatatcgccctgtacgag
gctggtctggccttccgggcggagcctgtcgatctgaaggccaagacactggccggcggc
gcagactttcgccaagtgaatccgctcggctatgtgccggtgctggagttggacgggggc
gagcgattgaccgaggtgggtgtggtcttgcagtacatcgcggaccagaagccggagact
tctctggcgccgccggcggggacgatgccgcgctatcgcctgatgcaatggctggcattc
atttcttccgaattgcacaaaaccttcagtccgttgttcgccccgcatacgcccgaggat
tacaagccggtgatacgcgagcgcctggcgcagcggcttgcctatatgaatcagcagctc
gcggcgagcagcttcctgatgggcgaacagtttacggtcgcggatgcctatctgttcgtg
gtgctgaattgggcgggtgtaatgaatctggacttgacaccctatgctcacctgcagtct
ttccagaagcgcgtcggcgcccgcccgggggtgcagcgcgccttgcaggccgaagggctg
ctcgggtcctaa

DBGET integrated database retrieval system