KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_03325Help
Entry
SDE12394_03325    CDS       T02017                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDE12394_03325
  Energy metabolism
   00680 Methane metabolism
    SDE12394_03325
Enzymes [BR:sdg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SDE12394_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
632904..635669
Genome map
AA seq 921 aa AA seqDB search
MSLKKLESSNNQAIIAEEVAILKDMLEKITRRMIGDEAFATIETIVALSEKQDYVGLETI
IASISNQDMDVISRYFSILPLLINISEDVDLAYEINYQNNANKDYLGKLALTIDAVAEKE
NAKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHDLLRKYRDVKAGVVNQEKWHNELYR
YIEIIMQTDIIREKKLKVKNEITNVMQYYNGSLIQAVTKLTTEYKNLAQKRGLDLINPNP
ITMGMWIGGDRDGNPFVTAETLRLSATVQSEVILNYYIEKLAALYRTFSLSSTLIQPSAE
VERLASLSQDQSIYRENEPYRRAFHYVKSRLVQTRTQLTGDQDTTGQSLTADRLTRQLAM
QDQLEGPIAAYVSPEDFKADLMAIEQSLLSNGDVALVDGDLREVMQAVDIFGFFLASIDM
RQDSSVQEACVAELLKGANIVEDYSSLSETEKCDLLVKQLTEDPRTLSSAAVAKSDLLEK
ELAIYAAARELKDKLGDEVIKQHIISHTESVSDMFELAIMLKEVGLIDQHKARVQIVPLF
ETIEDLDNARDIMTTYLSYDMVKSWIAANHNYQEIMLGYSDSNKDGGYLASGWTLYKAQN
ELTAIGEENGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYG
NKDVAYYHLEMLISASINRMVTQMLTNPNEIDGFREVMDGIVADSNKIYRQLVFDNPHFY
DYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFK
HYIDQAEGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLADSQEVRDVFHV
ILDEWQLTKNVILAIEGHEELLEDNPSLKQSLAFRLPYFNVLNYIQIELIKRLRNHQLRE
EDEKLIHTTINGIATGLRNSG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacttaaaaagctagagagtagtaacaaccaagctattattgctgaggaagttgct
attttaaaagatatgttggaaaaaatcacccgtcgaatgattggagatgaggcgttcgca
acgattgaaaccattgttgctttatctgaaaagcaagattacgttgggttagaaacgatt
atcgcaagcatttctaatcaagatatggatgtgatttcaagatacttttcaatcttgcct
ctgttaattaacatttcagaagatgtggatttggcttatgaaatcaattatcaaaataat
gccaacaaggattatttaggcaaacttgccttaactattgatgccgtcgcagaaaaagag
aatgccaaagacatcttagagcaggttaatgtggtacctgttttgacagcccatccgaca
caagtgcagcgcaagaccattttggagttgacaacgcatatccatgatctccttcgtaag
tatcgtgatgtcaaagctggtgtcgttaaccaagagaagtggcataatgaactctatcgg
tacatagaaatcattatgcagacagatattatccgcgagaaaaaactcaaggtcaaaaat
gagattactaacgtcatgcagtattacaatggttctctcattcaagcagtgaccaaatta
acaactgagtataaaaacttggctcagaaacgtggcttagacttgatcaatcctaacccc
ataaccatgggcatgtggattggaggagatagggatgggaatccttttgtcacagctgaa
accctaaggttatctgctacggttcagagcgaagtcatcctgaattattatattgaaaaa
ttagcagccctttaccgaaccttttctttgtcgtctaccttaattcaaccgagtgcagaa
gtagagcgtctggctagcttatcccaagaccagtctatttaccgtgaaaatgaaccttac
cgtagggcttttcattatgtgaagtcccgccttgtccaaacacgcactcaattgacaggg
gaccaagataccactggacagtcgctcacagcggatcgccttactcgtcagttagcaatg
caagatcagttagaaggacctattgctgcctacgtttcgccggaagactttaaagctgat
ttgatggccattgagcaatctcttttaagcaatggtgatgttgcactggttgatggagac
ttacgcgaagtgatgcaagctgttgatatttttggcttcttcctagcaagtattgacatg
aggcaagactctagtgtgcaagaagcatgtgtggcagagttattaaaaggagctaatatc
gttgaggattatagctcactttcagaaactgaaaaatgtgatcttcttgtgaaacaactg
acagaggatccaagaacactatcttcagcagcagttgctaagtcagatttgctcgaaaaa
gaattagcgatttacgcagctgcacgtgagttgaaggataagctaggtgacgaggtcatt
aagcagcacatcatttcgcacacagaaagtgtttctgatatgtttgaattggccatcatg
ctcaaagaagttggtctgattgaccaacacaaagctcgtgtgcaaattgtgccacttttt
gaaactattgaagacttagacaatgctcgtgacattatgacaacttacttgagttatgat
atggttaaatcatggattgcagctaatcataactatcaagaaattatgttaggttattct
gacagtaataaagatggtggttaccttgcttcaggttggaccctctataaagctcaaaat
gaattaacagccattggagaggaaaatggcgtgaaaatcactttcttccatggtcgtgga
ggaacagttggacgaggcggtggaccttcttacgatgccatcacctcacaaccttttggt
tctattaaagatcgcattcgcctcactgaacaaggggagattattgaaaataaatatggt
aataaagatgtcgcttattaccatttagaaatgctcatttcagcttctattaatcgtatg
gtcacacaaatgcttaccaaccctaatgaaattgacggattcagagaagtcatggatggt
attgttgcggacagtaataagatttaccgccagctagtatttgataatcctcatttttac
gattatttctttgaagcaagtcctatcaaggaagtttctagccttaacatagggtcaaga
ccggcagcccgtaaaacgattacggaaatcacaggcttgcgggctattccttgggtcttt
tcgtggtcacaaaatcgtatcatgttccccggatggtatggggtaggatcggcctttaaa
cattatattgaccaagcagaaggcaatcttgagcgtctccaacacatgtaccagacttgg
cccttcttccattccttattatcgaatgtggatatggtgctatcgaaatcaaatatgaac
atcgcttttcaatatgctcagttggcagacagccaagaggttagggatgtttttcatgtg
attttggacgaatggcagttgacaaaaaatgtgattcttgccatcgaaggacatgaggag
ttactagaagataacccatctttgaaacaaagtttagcttttcgtctcccttatttcaat
gtgttgaactatattcaaattgaattgattaagcgcctgcgcaatcatcagttaagagaa
gaggatgaaaaattaattcacacaacgattaatggaattgcgactgggttacgtaattca
ggctaa

DBGET integrated database retrieval system