KEGG   Shewanella denitrificans: Sden_0739Help
Entry
Sden_0739         CDS       T00344                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sdn  Shewanella denitrificans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sden_0739
Enzymes [BR:sdn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sden_0739
Transporters [BR:sdn02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sden_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
858689..859333
Genome map
AA seq 214 aa AA seqDB search
MITLYGTPRSRALRVSWALEELGLDWQFNFINFLKGDNRAQTFLGLNPSGKIPVLTDDDL
VVTESAAIVSYLAAQYGQETLLPSKTATKTELARFNEWYSFIISELEQPLWSMGKHKFAL
PEAQRLSAMRDVAMWEFDKAAAIAEDWTPESGFLLGDKFTIIDILLCHTLMWATVFEQTI
PAKLAAYRDRLQQRPALISALKKTEAIAKAAQAE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcactctctatggtaccccgagaagtcgtgcattgcgcgtgtcttgggcgttagaa
gaattaggcttagattggcaatttaactttattaatttcttaaagggtgacaaccgcgcg
cagactttcttaggcttaaacccaagcggtaaaattcctgtgctcacagatgatgatcta
gtcgtgacagaatctgccgccatcgtcagttatttagctgcgcaatatggccaagagacc
ttattaccgtcaaaaactgcaactaagacagagctggcgcgatttaacgagtggtacagt
tttattatcagcgagctcgagcagcctctatggagtatggggaagcacaagtttgcactt
cctgaggcacaaaggctcagcgctatgcgtgatgtggcgatgtgggagtttgataaggcg
gccgccattgccgaagattggaccccagaaagtggatttttgcttggcgataagtttacc
attatcgatattttattgtgtcacaccttgatgtgggccacagtattcgagcagacaatt
cctgcaaaactggccgcttatcgagaccggttacaacaaaggcccgccttgatttcagca
ctcaaaaaaacagaagccatagccaaagcggcccaagctgaatag

DBGET integrated database retrieval system