KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1866Help
Entry
SDEG_1866         CDS       T00932                                 

Gene name
acpS
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SDEG_1866 (acpS)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SDEG_1866 (acpS)
Enzymes [BR:sds01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SDEG_1866 (acpS)
Peptidoglycan biosynthesis and degradation proteins [BR:sds01011]
 Precursor biosynthesis
  Racemase
   SDEG_1866 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1793379..1794479)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQENIPLGVRTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELELAITRQVTVTVASLEWLAMAKQEWPD
LKGLKVHIKIDSGMGRIGLRSVTEVDNLIAGLKSMRAEVEGIFTHFATADEADTVKFEQQ
LTFFTNLVDQLADKPSLVHASNSATSLWHSETIFNAVRLGIVMYGLNPSGSELALPFPLK
EAFNLESVLVHVKEIAPGETVGYGATYKAQTSEYVGTVPIGYADGWTRDMQGFTVLVEGQ
PCEIIGRVSMDQMTIRLPRAYPLGTKVTLIGQDQEKVISTTDIANYRNTINYEVLCLLSD
RVPRVY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgagtttccatcgcccaacagttgcaagggtcaatttgcaagctattaaggag
aatgttgccagtgtccaagagaatattccactaggggtaagaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcacttctccctcaagtggat
gggtactgtgtgtcaaatcttgatgaggccttgcaattacgtcaagcaggtattgataaa
gagattttaattctcggggttttgctgccaaatgagctagagttggcgattactcgccag
gttacagtgacagtggctagtttagagtggttggcgatggccaagcaagaatggccagat
ttgaaagggcttaaggtccatatcaaaattgattcaggcatgggacgaatcgggcttcgc
tcagtaacagaagttgataacctgattgccggcttgaagagcatgagggcagaagtggaa
gggattttcactcattttgccacagctgatgaagctgataccgtaaagtttgagcagcaa
ttgactttctttaccaatttggttgatcagcttgccgacaagccaagtttggttcatgct
agcaattcagcgactagtctttggcacagtgagactatttttaatgcggttcgtttaggg
attgtcatgtatgggttaaacccaagcggttcagagttagctctgccattccccttaaaa
gaagcctttaatttagaatctgtcttggtgcatgttaaggaaatcgcccctggtgagacg
gtaggctatggggcaacctacaaagctcagactagcgaatatgtggggacggtgcccatt
ggttatgcagatggatggacgcgggatatgcaaggtttcactgtgcttgttgaaggacaa
ccctgtgaaatcattggtcgggtctctatggaccagatgaccatccgccttcctagagcc
tatccgcttggaacaaaggttaccctgattggtcaagatcaagaaaaagtgatttctaca
acagatatcgcaaactatcgtaacactattaattatgaggttctatgtctccttagtgat
cgtgttccaagggtgtattag

DBGET integrated database retrieval system