KEGG   Staphylococcus pseudintermedius ED99: SPSE_0707Help
Entry
SPSE_0707         CDS       T02008                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPSE_0707 (tdk)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPSE_0707 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
768777..769379
Genome map
AA seq 200 aa AA seqDB search
MYEAYHSGWIECITGSMFSGKSEELIRRLRRGVYAKQKVVVFKPTIDDRYHKEKIVSHNG
NEIEAINISKASEIWHHDLNGVDIIGIDEIQFFDRDIVDIAQTLAERGYRVITAGLDMDF
KGEPFHPVPEMLAVSEHITKLQAVCAVCGASSSRTQRLIDGKPAKVDDPIILVGANESYE
PRCRAHHIVAPSENDKEALE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagcgtaccattcaggttggatagaatgcattactggaagcatgtttagtggc
aagtcagaagagctcatcagacgcttacgccgaggtgtctatgcaaagcaaaaagtggtt
gtatttaaaccaacaattgatgaccgctaccataaagaaaaaattgtttctcataacggt
aatgaaatagaagcgattaacatttctaaagcaagtgagatatggcaccatgacttaaat
ggtgtggatattatcggtattgatgagattcaattttttgatcgagatattgtagacatt
gcacaaacgcttgccgaaagagggtaccgtgtaattactgcaggtcttgatatggatttt
aaaggcgaaccttttcaccctgttcctgaaatgctagcggtgagtgaacatattacaaaa
ttacaagcggtctgtgcggtttgtggggcatcatcgagtcgtacgcaacgattgattgat
ggtaaacctgcaaaagtggatgatccgattatacttgtaggtgcaaatgaaagttatgag
ccgcgttgtcgtgcacatcatatcgtagcaccgagtgaaaatgataaggaggcgttggaa
taa

DBGET integrated database retrieval system