KEGG   Staphylococcus pseudintermedius ED99: SPSE_1611Help
Entry
SPSE_1611         CDS       T02008                                 

Gene name
nanB
Definition
(GenBank) sialidase B
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPSE_1611 (nanB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPSE_1611 (nanB)
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPSE_1611 (nanB)
Bacterial toxins [BR:sdt02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPSE_1611 (nanB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1651714..1653801)
Genome map
AA seq 695 aa AA seqDB search
MRALKVWIYILSLLLIIGLVTPNAFAQVAGQKNGNEANTLVFEKDNIQLAGNGMNITSGA
LNKLTGPDFTVIIKYHQLKPDGIQALFGISNSKKGNPSSYLDMYVRENGELGMEARDTNT
KTNHLVSRPASVWGKYKNKPASNIVALVLNHYTKTYSLFSNGYKVEEKKVNNFLMLSNIN
GLDSFVIGGVNREGKNSFGFNGTIENIKIFNNALDENTIKSMTKNDITQRLIYKANDETH
SNYFRIPSLYTLSNGRVLSSIDARYGGTHDFLNKINIATSYSDDNGNSWTKPKLTLSFDD
FESVPLEWPRDPGKRDWQISGGATYIDSVLLEKNDKQVMLFADVMPAGVSFREAVRNDSG
FKKINEKYYLKLKKSGENDYQYTVRENGIIYNDRTNKPTEYSVDKNFAISKNNKKLKVEQ
YSAKVINGQKTEFKNGKFVDMNVFYKDALFKVVPTNFIAYSVSDNFGTSWTKPTLIPSLL
GDKHNSPYLGPGRGIVEHSKGRILIPSYTGKDSVFIYSDDNGRTWKTKIIPLPSSWSAEA
QIIELQPGVLQAYMRTNNGKIAFITSKDAGNTWSNPNYLDFISNPNYGTELSIINYSQKI
DGKNAVILSTPNSKNGRRNGQIWIGLLGENNKIEWRYHHDVDYSQYGFSYSTLTELPNHD
IGLMYEKFDSWSRNELHIKNVIPYVSYKIEDLKNN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagggcattaaaagtatggatatatatactgtcattattgctaataattggcctcgtt
actccaaatgctttcgctcaagttgctggacagaaaaatggaaatgaagcaaatacacta
gttttcgaaaaagataatattcagttagcaggtaatggaatgaatataacatctggtgcc
ttaaacaaactaactggacctgattttacagtgataatcaagtatcatcaattgaaacct
gatggaattcaagctttatttggtatttctaattcaaaaaaaggtaacccaagtagttat
ttagatatgtatgtaagagaaaatggagaattaggtatggaagctcgtgacactaataca
aaaacaaatcatctggtatcaagacctgcttctgtatgggggaaatacaaaaataaacca
gcatcaaatatagtggcgttggtattaaatcattataccaaaacgtattctttattttct
aacggatataaagtagaagaaaagaaggttaataattttttaatgctttcaaacatcaat
gggttagactcatttgttattggcggagtaaatagagaaggaaaaaatagttttggattt
aacggtacaatcgaaaatattaaaatcttcaataatgcactagatgaaaatacaataaaa
agcatgacgaaaaatgacataactcaacggttaatttataaggcgaatgatgaaacgcat
tcaaattatttcagaataccatctttatatacattaagtaatggtagagttttatcaagt
atcgacgctcgttatgggggtacacatgactttttgaataaaattaatattgcaactagt
tatagtgatgataatggtaactcatggacaaaaccaaagctcacattatcttttgatgat
tttgaatcagtaccattggaatggcctcgtgatccggggaaacgtgattggcaaattagt
ggtggtgcgacatatatagattcggttttattggaaaaaaatgataaacaggttatgctt
tttgctgatgttatgcctgcaggagttagctttagggaggctgtaagaaatgattcagga
tttaaaaaaattaacgaaaaatactatcttaaattgaaaaaaagtggagaaaatgattat
caatatacagttcgtgaaaatggaatcatttataatgatagaacaaataaacctactgag
tattctgtagataaaaactttgcaataagtaaaaacaataaaaaattaaaggtagagcaa
tattcagcaaaagttatcaatggacaaaaaactgaatttaaaaatggtaagtttgttgat
atgaatgttttttataaagacgctttatttaaagtagttccaactaatttcatagcatat
tcagtaagtgataactttggaacatcttggactaaacctacacttatcccgtcgttactt
ggagataaacataattctccatatttaggtcctggccgaggtattgtggagcatagtaag
gggagaattctaataccttcttatactggtaaagattctgtgtttatctatagtgacgat
aatggaagaacgtggaagactaaaattattccgcttccttcaagctggtctgcagaggct
caaataatagaattacaaccgggtgttttacaagcttatatgagaacgaataatgggaaa
attgcattcattactagtaaagatgcaggtaatacgtggagtaatcctaactatttagat
tttatttctaatcctaattacggaacagaactgtctattattaattatagtcagaaaata
gatggcaaaaatgccgtaattcttagtacaccaaattcaaaaaatggtagaagaaatggt
caaatttggattggtttattaggagaaaataacaagattgagtggcgttatcaccacgat
gtcgactacagtcaatatggcttttcatattcaacattaactgaactgcctaaccatgat
atagggttgatgtatgaaaaattcgactcttggtcacgaaatgaactgcatattaaaaat
gtaattccgtatgtcagttataaaattgaagacttgaaaaacaattag

DBGET integrated database retrieval system