KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4360Help
Entry
SeAg_B4360        CDS       T00751                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeAg_B4360 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SeAg_B4360 (ppc)
Enzymes [BR:sea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SeAg_B4360 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4254065..4256803)
Genome map
AA seq 912 aa AA seqDB search
MTWVGERSQRRRSVKDAGQLQQRWGVWDHMNEQYSALRSNVSMLGKVLGETIKDALGEHI
LDRVETIRKLSKSSRAGNEANRQELLTTLQNLSNDELLPVARAFSQFLNLANTAEQYHSI
SPKGEAASNPEVIARTLRKLKNQPDLNDATIKKAVESLSLELVLTAHPTEITRRTLIHKM
GEINNCLKQLDNTDIADYERHQVMRRLRQLIAQSWHTDEIRKQRPSPVDEAKWGFAVVEN
SLWQGVPNYLRELNEQLEENLGYKLPVDFVPVRFTSWMGGDRDGNPNVTADITRHVLLLS
RWKATDLFLKDIHVLVSELSMVDATPELLALVGEEGASEPYRYLMKKLRARLMATQSWLE
ARLKGEKLPKPAGLLTQNEQLWEPLYACYQSLQACGMGIIANGELLDTLRRVKCFGVPLV
RIDIRQESTRHTEALGEITRYLGIGDYESWSEADKQAFLIRELNSKRPLLPRNWEPSNDT
REVLETCKVIAEAPKGSIAAYVISMAKTPSDVLAVHLLLKEAGIGFAMPVAPLFETLDDL
NNADDVMTQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKA
GIELTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPEVTVSSL
SLYTSAILEANLLPPPEPKDSWRHIMDELSVISCETYRGYVRENKDFVPYFRSATPEQEL
GKLPLGSRPAKRRPTGGVESLRAIPWIFAWTQNRLMLPAWLGAGTALQKVVEDGKQSELE
AMCRDWPFFSTRLGMLEMVFSKADLWLADYYDQRLVAKTLWPLGKELRDLLEEDIKVVLA
IANDSHLMADLPWIAESIQLRNVYTDPLNVLQAELLYRSRLTEEQGKSPDPRVEQALMVT
IAGVAAGMRNTG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgggtgggagagcgcagccaacgccgccgcagcgtgaaagatgcaggacaatta
caacagagatggggtgtctgggatcatatgaacgaacaatattccgcgttgcgtagtaat
gtcagtatgctcggcaaggtgctgggagaaaccatcaaggatgcgctgggagaacacatt
cttgatcgcgtagaaacaatccgtaagctatccaaatcttcacgcgccggcaatgaagct
aatcgccaggagctgctcaccacgctacaaaatttgtctaatgacgagctgctgccagtt
gcgcgcgcgtttagtcagttcctgaacctggccaatactgccgagcaataccacagcatt
tcgccaaaaggcgaagccgccagcaacccggaagtgattgcccgcactctgcgtaaactg
aaaaaccaaccggacctcaacgacgcaaccatcaaaaaagcggtagagtcgctgtctctg
gagttggtgctaaccgcccatccgacagaaattacccgccgtacgcttattcacaaaatg
ggtgaaatcaacaactgtctgaaacagcttgataataccgatatcgccgactacgaacgc
caccaggtaatgcgtcgcctgcgccagttgattgcccaatcctggcatacggatgagatc
cgcaagcagcgtccaagcccggtggatgaagccaaatggggcttcgccgtggttgagaac
agcctgtggcagggcgtacctaactatctgcgtgaactgaacgaacagctggaagaaaat
ctcggctacaaattgccggtggattttgtgccggtacgttttacctcctggatgggcggc
gaccgtgacggcaacccgaacgtgacggcggatatcacccgccacgtactcttgttaagc
cgctggaaagccaccgatctgttcctgaaagacattcatgttctggtatcagaactgtcg
atggtcgacgccacgccggagctgctggcgttagtgggcgaagaaggcgcgtctgagccg
tatcgctacctgatgaaaaaattacgcgcccgtctgatggcgacccagtcctggctggaa
gcgcgtctgaaaggcgagaagctgcccaaaccggctggcctgctgacgcaaaacgagcag
ctctgggaacctctgtacgcctgctaccagtcgttacaggcctgcggtatgggcattatc
gccaacggcgagttactcgacacgctccgccgcgtgaagtgtttcggcgtaccgctggtg
cgcattgatatccgtcaggagagcacccgccataccgaagcgctgggcgaaattacccgc
taccttggtattggcgactacgaaagctggtcggaagccgacaagcaggccttcctgatc
cgcgagctgaactccaaacgtccgctgctgccgcgtaactgggagccgagcaacgatacc
cgcgaagtgcttgaaacctgcaaggttattgccgaagcaccaaaggggtcgatcgccgcc
tacgtgatttcaatggcgaaaacgccgtctgatgtgctggctgtgcatctgctgctgaaa
gaggcaggtatcggctttgccatgccggtcgcgccgctgtttgaaaccctcgacgacctg
aacaacgccgacgacgtgatgacccagttgttgaatatcgactggtatcgcgggctgatt
cagggtaagcagatggtcatgatcggctactccgactcggcgaaagacgccggcgttatg
gccgcgtcatgggcgcagtatcaggcgcaggacgccctgatcaaaacttgtgaaaaagct
ggcatcgagctcaccctcttccacggccgcggcggctctattggccgtggcggcgcgcca
gcccacgcggcgctgctttcgcaaccgccaggcagtctgaaaggcggcctgcgcgtgacc
gagcagggcgagatgatccgcttcaaatacggcctgccggaagtcaccgtcagcagcctg
tcgctctacaccagcgcaattctggaagcaaacctgctgccgccgccggaaccgaaagac
agctggcgtcatattatggatgagctttccgtcatctcctgtgaaacctaccgcggttac
gtgcgcgaaaataaagactttgtaccgtacttccgctccgcgacgccggaacaagagctg
ggcaaattgccgctcggctcacgtccggcgaaacgtcgtccaactggcggcgtcgaatcg
ctgcgcgcgattccgtggatcttcgcctggacgcaaaaccgcctgatgctgccagcctgg
ctgggcgcgggtactgcgctgcaaaaagtggtggaagacggtaaacaaagcgaactggaa
gccatgtgccgcgactggccgttcttctccacgcgtcttgggatgctggaaatggtattc
tcgaaagccgacctgtggctggccgactattacgatcagcgtctggtggcgaaaacgcta
tggccgctgggcaaagagctacgagacctgctggaagaagacattaaagtggtgctagcg
attgccaacgattcgcacctgatggccgacttaccgtggattgcggagtccattcagtta
agaaacgtttataccgatccattaaacgtgttgcaggccgagttgctgtatcgttcccgt
ctgactgaagagcagggcaaatcgcccgatcctcgcgtcgaacaggcgttgatggtcacg
attgcgggcgtcgccgccggtatgcgcaacaccggctaa

DBGET integrated database retrieval system