KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_0127Help
Entry
SCH_0127          CDS       T00240                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B, affects cell division
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00473  D-Alanine metabolism
sec00550  Peptidoglycan biosynthesis
sec01100  Metabolic pathways
sec01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCH_0127 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCH_0127 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCH_0127 (ddlB)
Enzymes [BR:sec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCH_0127 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:sec01011]
 Precursor biosynthesis
  Amino acid ligase
   SCH_0127 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AAX64033
UniProt: Q57TC8
LinkDB All DBs
Position
146943..147863
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGSAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggctcggcagtgttggccgggttacgtgaaggcggtattgatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgtggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggcagcggcgtgatggcctcggcgctttcaatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgccccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggccttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacggtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagaagcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgacgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system