KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1912Help
Entry
SeD_A1912         CDS       T00757                                 

Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SeD_A1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1848054..1848635
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRTS
EGGIFNNAAQVWNHTFYWNCLAPNAGGEPTGKLAEAIAASFGSFAEFKAQFTDAAIKNFG
SGWTWLVKSADGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccgtatgccaaagatgctctggcaccgcatatttct
gctgagacgctggaatatcactatggcaaacatcatcagacttacgtgaccaatcttaac
aatttgatcaaaggcacggcgtttgaaggcaaatcgctggaagagatcgtgcgcacttcc
gaaggcggcatctttaataacgccgctcaggtatggaaccacaccttctactggaactgc
ctggcgccaaacgctggcggcgaaccgaccgggaaactggctgaagctatcgcggcatct
tttggcagcttcgcggaatttaaagcgcagttcaccgatgccgctatcaaaaactttggt
tccggatggacatggctggtaaaaagcgctgatggcaaactggctatcgtttctacctca
aatgccggtacgccgctgactacggatgcaacgccgttgctgacggttgatgtgtgggaa
cacgcgtattacatcgactaccgcaacgcccgtccaaactatctggagcatttctgggcg
ctggttaactgggaatttgttgcgaaaaatctcgccgcataa

DBGET integrated database retrieval system