KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A3896Help
Entry
SeD_A3896         CDS       T00757                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SeD_A3896
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SeD_A3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3728482..3729990
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSMAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccgggcgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgagcactacgag
ttccgtctggtcagcgaagcgctggcagaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcatttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtgctcaaaccggaaatcgtgcgcggattcgaa
tattccgactgctgggtagacgatgcgcgtctggtgctggctaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggaccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccatatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacgaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtttataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggcgtccgtccgctgtgc
gatgatgagtccgactcaccgcaggcgatcactcgcgattatacccttgatattcatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcttattatccaggcatcggcccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcgctgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgaa
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcaatg
gcgtcgtaa

DBGET integrated database retrieval system