KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A2536Help
Entry
SNSL254_A2536     CDS       T00739                                 

Definition
(GenBank) glutathione S-transferase, N-domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
Enzymes [BR:see01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SNSL254_A2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ACF62625
UniProt: A0A0H3BNM8
LinkDB All DBs
Position
2459385..2460032
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKIALFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DSYPAVYNWFERIRTRPATARALLQAQLHCNSTKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaatagcgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctggcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccac
tttgcgccgcaggccatcccctatgcaattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatagctacccggcggtgtataactggtttgaacgcattcgcacgcgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtacgaaagcgtaa

DBGET integrated database retrieval system