KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_021745Help
Entry
SEEB0189_021745   CDS       T02739                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEEB0189_021745
  Energy metabolism
   00680 Methane metabolism
    SEEB0189_021745
Enzymes [BR:seeb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SEEB0189_021745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4488298..4490949
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELL
ALVGEEGASEPYRYLMKKLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDSWRHIMDEL
SVISCETYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAD
YYDQRLVAKTLWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLYRSRLTEEQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaggatgcgctgggagaacacattcttgatcgcgtagaaacaatccgtaag
ctatccaaatcttcacgcgccggcaatgaagctaatcgccaggagctgctcaccacgcta
caaaatttgtctaatgacgagctgctgccagttgcgcgcgcgtttagtcagttcctgaac
ctggccaatactgccgagcaataccacagcatttcgccaaaaggcgaagccgccagcaac
ccggaagtgattgcccgcactctgcgcaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtcgctggagttggtgctaaccgcccatccgaca
gaaattacccgccgtacgcttattcacaagatgggtgaaatcaataactgtctgaaacag
cttgataataccgatatcgccgactacgaacgtcaccaggtgatgcgtcgcctgcgccag
ttgattgcccaatcctggcatacggatgagatccgcaagcagcgtccaagcccggtggat
gaagccaaatggggcttcgccgtggttgagaacagcctgtggcagggcgtacctaactat
ctgcgtgaactgaacgaacagctggaagaaaatctcggctacaaattgccggtggatttt
gtgccggtacgttttacctcctggatgggcggcgaccgtgacggcaacccgaacgtgacg
gcggatatcacccgccacgtactcttgttaagccgctggaaagccaccgatctgttcctg
aaagacattcatgttctggtatcagaactgtcgatggtcgacgccacgccggagctgctg
gcgttagtgggcgaagaaggcgcgtctgaaccgtatcgctacctgatgaaaaaattgcgc
gcccgtctgatggcgacccagtcctggctggaagcgcgtctgaaaggcgagaagctgccc
aaaccggctggcctgctgacgcaaaacgagcagctctgggaacctctgtacgcctgctac
cagtcgttacaggcctgcggcatgggcattatcgccaacggcgagttactcgacacgctc
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgccaggagagcacc
cgccataccgaagcgctgggcgaaattacccgctacctcggtattggcgactacgaaagc
tggtcggaagccgacaagcaggccttcctgatccgcgaactgaactccaaacgtccgctg
ctgccgcgtaactgggagccgagcaacgatacccgcgaagtgcttgaaacctgcaaggtt
attgccgaagcgccaaaaggatcgatcgccgcctacgtaatttcaatggcgaaaacgccg
tctgatgtgctggctgtgcatctgctgctgaaagaggcaggtatcggctttgccatgccg
gtcgcgccgctgtttgaaaccctcgacgacctgaacaatgccgacgacgtgatgacccag
ttgttgaatatcgactggtatcgcgggctgattcagggtaagcagatggtcatgatcggc
tactccgactcggcgaaagacgccggcgttatggccgcgtcatgggcgcagtatcaggcg
caggacgccctgatcaaaacctgtgaaaaagccggcatcgagcttaccctcttccacggc
cgcggcggatctattggccgtggcggcgcgccagcccacgcagcgctgctttcgcaaccg
ccaggcagtctgaaaggcggtctgcgcgtgaccgagcagggcgagatgatccgcttcaaa
tacggcctgccggaagtcaccgtcagcagcctgtcgctctacaccagcgcaattctggaa
gcaaacctgctgccgccgccggaaccgaaagacagctggcgtcatattatggatgagctt
tccgtcatctcctgtgaaacctaccgcggttacgtgcgcgaaaataaagactttgtaccg
tacttccgctccgcgacgccggaacaagagctgggcaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaactggcggcgtcgaatcgctgcgcgcgattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtactgcgctgcaaaaa
gtggtggaagacggtaaacaaagcgaactggaagccatgtgccgcgactggccgttcttc
tccacgcgtcttgggatgctggaaatggtgttctcgaaagccgacctgtggctggccgac
tattacgatcagcgtctggtggcgaaaacgctatggccgctgggcaaagagctacgagac
ctgctggaagaagacattaaagtggtgctggcgattgccaacgattcgcacctgatggcc
gacttaccgtggattgcggagtccattcagttaagaaacgtttataccgatccattaaac
gtgttgcaggccgaattgctgtatcgttcccgtctgactgaagagcagggcaaatcgccc
gatcctcgcgtcgaacaggcgttgatggtcacgattgcgggcgtcgccgccggtatgcgc
aacaccggctaa

DBGET integrated database retrieval system