KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_18675Help
Entry
CFSAN002050_18675 CDS       T02734                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Brite
Enzymes [BR:seec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CFSAN002050_18675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3512708..3513355
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaataacgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctggcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccat
tttgcgccgcaggccatcccctatgcgattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatacctacccggcggtgtataactggtttgaacgcattcgcacacgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtacgaaagcgtaa

DBGET integrated database retrieval system