KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_05855Help
Entry
I137_05855        CDS       T02790                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:seep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    I137_05855
Enzymes [BR:seep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I137_05855
Transporters [BR:seep02000]
 Other Transporters
  Pores ion channels [TC:1]
   I137_05855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1297524..1298105)
Genome map
AA seq 193 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAA
LEKKFQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIESYMQRVAKR
PTVAAALKAEGLN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccacattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtactggaatggctcaactatattgcaacggaactgcataaaggc
tttaccccgctgttccgccctgacacgccggaaactcttaaacccgccgttcgcgccgct
ctggaaaagaaatttcagtatgtggatgaatcgctttcagacgaccagtggatttgcggc
cagcgttttaccatcgcagacgcttatctgtttaccgtattgcgttgggcctatggcgta
aaactgaatatggacgggttaacgcatattgaaagttatatgcagcgtgtcgcaaaaaga
ccgaccgttgcggcagcgcttaaagcggaaggactgaattaa

DBGET integrated database retrieval system