KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1286Help
Entry
UMN798_1286       CDS       T01782                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00020  Citrate cycle (TCA cycle)
sef00480  Glutathione metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
sef01210  2-Oxocarboxylic acid metabolism
sef01230  Biosynthesis of amino acids
Module
sef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sef_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UMN798_1286 (icdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    UMN798_1286 (icdA)
Enzymes [BR:sef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UMN798_1286 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AFD58184
LinkDB All DBs
Position
1281311..1282561
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggtggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttattgaaggcgatggtatcggtgttgat
gtcactccagccatgcttaaagtagtcgatgccgccgtcgagaaagcctataaaggcgag
cgtaaaatttcctggatggaaatttacaccggagaaaaatccacacaggtttacggccag
gatgtctggcttcccgctgaaacccttgatttaattcgtgactaccgcgtagcgattaaa
ggtccattgaccacgccggttggcggcggtatccgctctctgaacgttgccctgcgtcag
gagcttgacctgtacgtttgtctgcgtcccgttcgttactatcagggcacgccaagtccg
gtgaaacatccggagctgaccgatatggtcatcttccgtgaaaactctgaagacatctac
gccggaattgaatggaaagctgactctgcagacgctgagaaagtgatcaagttcctgcgc
gaagagatgggcgtgaagaaaattcgcttcccggagcactgcggtatcggtatcaaaccg
tgttctgaagaaggcactaaacgtctggttcgcgcggcgattgaatacgctattaccaac
gatcgcgattccgtcacgctggtacataaaggcaatatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagttggcgcgcgacgagttcggcggtgagcttattgacggc
ggtccgtggctgaaaattaagaacccgaacacgggtaaagagatcgtggttaaagacgtt
atcgccgatgcgttcctgcaacaaatcctgttgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggtgactatatttccgatgccctggcggctcaggttggcggtatc
ggtattgcaccgggtgcgaatatcggcgacgaatgcgcgttgtttgaagcgactcacggg
actgcgccgaaatatgcgggccaggataaagtcaacccaggctccattattctgtctgcg
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgattgccgcgaagaccgtgacctatgactttgaacgcctgatggaaggcgct
aagctgctgaaatgtagtgagtttggtgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system