KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4308Help
Entry
SPC_4308          CDS       T00862                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00473  D-Alanine metabolism
sei01100  Metabolic pathways
sei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPC_4308 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPC_4308 (alr)
Enzymes [BR:sei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SPC_4308 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sei01011]
 Precursor biosynthesis
  Racemase
   SPC_4308 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACN48370
UniProt: C0Q523
LinkDB All DBs
Position
4397991..4399070
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFSA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagcctatcctgctgctggagggt
tttttcgacgccgccgatctgccgaccatttccgcgcaatgtctgcataccgccgtacat
aatcaagagcagcttgccgccctggaggcggtggagctggcggagccggtaacggtctgg
atgaaactggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaagcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttagtgcc
ttctgtcagggtaaacccgggcagcgctctattgccgcgtctggcggtatcctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcattattttgtatggcgtatcgccgctg
gagcacaaaccctgggggccggattttggttttcagccggtgatgtccttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggctacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggcgatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtactggtcaatggtcgtgaagttccgattgtcgggcgg
gtggcgatggatatgatttgcgtggatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggtgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system