KEGG   Selenomonas sp. oral taxon 136: AXE86_02635Help
Entry
AXE86_02635       CDS       T04745                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:selo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXE86_02635
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AXE86_02635
Enzymes [BR:selo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AXE86_02635
Peptidoglycan biosynthesis and degradation proteins [BR:selo01011]
 Precursor biosynthesis
  Racemase
   AXE86_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(578410..579516)
Genome map
AA seq 368 aa AA seqDB search
MPNRAAWAEIDLGALAHNYREIRSRIQKGAKLCAVVKADAYGHGAIAAARVALDEGADYL
AVATLSEALKLRAAGFTAPLLILGLVEPESAREVVDGDITQTVCRMDLVEALSQEAVRQG
KTVKVHLTIETGMGRIGVHPKDAAETAKKIAALPNVELEGIFSHFALADIPDKTFTKQQV
KLFKDACDAIEAAGIHIPIKHIAESAAILEIPDVHFDMVRAGIIQYGLWPSDEVTRPIDL
RPCMKFCARIVYIKTIQPGESVGYGRKFIAERETRIATLPVGYADGYIRAYAGGSVEVCG
KRAPIAGRVCMDQFMIDVTDIPEAKLGDVCTLFGSDGLTADEIAGWANTINYEVVCLVSE
RVPRVYKG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatcgagcagcatgggcggagattgatctaggggcgctcgcccataactatcgt
gagattcgcagccgaatccaaaagggagcaaagctatgtgctgtggtgaaggcggatgca
tacggacacggagcgatcgccgcagcgcgggttgcgctcgatgagggggcggactacctc
gcggtagcaacgctctcggaggcactcaagctgcgggcggcaggctttacagcaccactc
ctcatccttgggctcgtggagccggagagtgcacgtgaggtcgtcgatggtgatatcacc
cagacggtctgccgcatggatctcgttgaagcactgtcgcaggaagctgtacggcagggc
aagacagtgaaagtgcatctgaccattgagaccggtatggggcgtatcggcgtgcatccg
aaggatgcggcagagacggcgaagaagattgccgcactccccaatgtggagcttgagggg
atcttctcccactttgcactcgctgatattccggataagacgtttaccaaacagcaggtc
aaactcttcaaggacgcctgcgatgcaattgaggcggcgggcattcatatccccatcaag
cacattgcagagtcagcagcgatccttgagattcccgacgtgcacttcgatatggtgcgc
gccggcatcatccagtatggtctctggccctcggatgaggtgacgcgcccgattgacctc
cgtccgtgcatgaaattctgtgcgcgaatcgtctatatcaagacgattcagcccggagag
tctgtcgggtatggacgcaagtttattgcagagcgtgagacacgcatcgcaactctgccc
gtcggctatgcagacggctacattcgtgcctatgcaggcggcagtgtcgaggtgtgcggg
aaacgcgcgcccatcgcaggacgtgtctgcatggatcagtttatgatcgatgttacggat
attcccgaggcaaaattgggggatgtctgtacgctcttcggctcggatggtctgacggca
gatgagattgcggggtgggcaaatacaatcaactatgaggttgtctgtcttgtttccgaa
cgtgtgccgcgtgtgtataaagggtag

DBGET integrated database retrieval system