KEGG   Selenomonas sp. oral taxon 136: AXE86_02750Help
Entry
AXE86_02750       CDS       T04745                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo00471  D-Glutamine and D-glutamate metabolism
selo00550  Peptidoglycan biosynthesis
selo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:selo00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AXE86_02750
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXE86_02750
Enzymes [BR:selo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AXE86_02750
Peptidoglycan biosynthesis and degradation proteins [BR:selo01011]
 Precursor biosynthesis
  Amino acid ligase
   AXE86_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Mur_ligase_M Mur_ligase_C Mur_ligase Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST Imm47 TTL
Motif
Other DBs
NCBI-ProteinID: AME03091
UniProt: A0A0X8K9M9
LinkDB All DBs
Position
complement(602732..605080)
Genome map
AA seq 782 aa AA seqDB search
MLKELKGIQKIHFVGIGGAGMSPLAKILLQLGYTVSGSDTGNSPLIGVLARLGAHVWTDG
QHAEHVRGADAIVVSTAIPYDNPEVIAAWDLRIPKLHRSDINAALVNEYDGIAVAGSHGK
TTTTSMIGVTLDRVGVSPTIIVGGEVPDLGTNAKLGTSRYLVSEADESDGSFLKLRPHIA
VVTNVEDDHMDHYGTMEKIIAAFRQFIEQVDTDGTAVLCFENEILRNIARETAHKVVSYA
IDHEADYRASNIETRGSVISFTVHERGTEMGRVLLNIPGRHNVLNALACIAVARLAGVEF
PAICDALAQFHGAKRRFQTKGKERGVWVVDDYAHHPTEIAVTLAAARQTNPERLICVFQP
HRYSRTQLLRAEFGKCFADADLLLITDVYAAGETPIPGISGETVMEEVVRQTGQDVVYLP
DRADLERYLAQQVRAGDLVITMGAGNILEVGETLVAQLRAGTAGTAGIVESDAYPIVVVM
GGPSSEAEVSRRSGAAILRALCAKGYPAVGMELNPATFAEEIQALHPAIVFNALHGKYGE
DGILQGTLDMLGIPYTGSGVRAAALTMDKIMAKRVLAAEDIPTPRCMSFYASERTADTPR
EIRTAFSLPLVVKAPEQGSSIGVYIVTRDEELSPALDAAFSYGDEVLVEEFIEGRELTAA
VWGTPAAAEVMPVIEIRSVSGRYDYDSKYTPGASTHIVPAPLSDACRSEVEQLARRAYAA
CGCSGLARVDLLLSAENRPYVIELNAVPGMTETSLVPDAARALGIEFPELCERILALAGY
RR
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaaggaattgaaggggattcagaagattcattttgtcggaatcggcggggcgggg
atgagccccttggccaagatccttctccagctcggctacacggtatccggctcggacacg
ggcaactctccactcatcggcgtgctggcccgtcttggtgcgcatgtgtggacggacgga
cagcatgcggagcacgtgcgcggcgcagatgccatcgtcgtctccacggcgatcccgtac
gataaccccgaggtgattgcagcgtgggatctgcgcatccccaagctccatcgttcggac
atcaatgcggcactcgtcaacgagtacgacggtatcgccgtcgcgggctcgcacggcaag
acgacgacgacctcgatgatcggcgtgactcttgaccgcgtcggcgtatcgccgaccatc
atcgtcggcggtgaggtgcccgacctcgggacgaatgcgaagctcggcacgagccgctac
ctcgtctcggaggcggacgagagcgacggctccttcctcaagctgcgcccgcatatcgct
gtggtgaccaacgtcgaggacgaccacatggatcactacggaacgatggagaagatcatt
gcggcattccgtcagttcatcgagcaggtggatacggacgggacggcagtgctctgcttt
gaaaacgaaatcctgcgcaatatcgcacgcgagacagcgcataaggtcgtttcctacgcc
atcgaccatgaggcggattaccgcgcatcgaacatcgagacgcgcggctctgtgatctcg
tttaccgttcatgagcgcgggacggagatggggcgcgtgctgctcaatattccggggcgc
cacaacgtcctcaacgcgctcgcctgtatcgccgttgcgcgcctcgcgggtgtggagttc
cctgcgatttgtgacgcactcgcccagttccacggtgcgaagcgtcgcttccagacgaag
ggaaaggagcgcggcgtctgggtcgtggacgactatgcgcatcatccgacggagatcgcc
gtcacccttgcggcagcacggcagacgaaccccgagcgacttatctgcgtctttcagccg
catcgctactcgcggacacagctcctgcgcgcggagtttggaaaatgctttgcggatgcc
gacctgcttctgatcacggatgtctatgcggcgggagagacaccgattccgggcatcagc
ggtgagaccgtgatggaggaagtcgtgcgtcagacgggacaggacgttgtctacctgccg
gaccgtgcggatctcgaacgctatctcgcccagcaggtgcgtgcgggcgacctcgtcatc
acgatgggcgcgggcaacatcctcgaggtcggtgagacactcgtcgcgcagctgcgcgca
ggaacagcggggacggcaggtatcgtggagtcggatgcgtatccgatcgtcgtcgtcatg
ggcggcccctcctccgaggcagaggtctcgcgccgctcgggtgctgccatcctgcgggca
ctctgcgccaagggctatcccgccgtcggcatggagctgaaccccgcaacctttgccgag
gagattcaggcactccatcctgcgattgtgttcaacgccctccatgggaaatatggcgag
gacggcatcctgcagggcacgctcgacatgctcggcattccgtatacgggctctggtgtg
cgcgccgctgcgctgaccatggataaaatcatggcaaagcgcgtactggccgccgaggac
atcccgacgccgcgctgcatgagcttctatgcgagcgagcgcacggcggatacgccgcgt
gagatacggactgcattctccctgccgctcgtcgtcaaggcaccggagcaggggtcgagc
atcggcgtctacatcgtcacgcgggacgaggagctctcgccagcgctcgatgcggcgttc
tcctacggggatgaggtgctcgtcgaggagttcatcgaggggcgagagctgaccgccgct
gtctggggtactccagccgcggcagaggtcatgcccgtcatcgagatccggtctgtttcg
ggacgctatgactacgacagtaagtataccccgggggcatcgacacatatcgtcccggca
ccgctctccgatgcgtgccgcagtgaagtcgagcaactggcacgccgtgcgtacgccgcc
tgtggctgcagcggtctcgcgcgcgttgatctcctgctgagcgcagagaatcgtccctac
gtcattgagctgaacgccgtaccgggcatgacagagacctcgcttgtcccggatgcggcg
cgtgcgctcggcatcgagttccccgagctgtgcgaaaggatcctcgcgttggcggggtat
cggcgatga

DBGET integrated database retrieval system