KEGG   Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069: CFSAN002069_20200Help
Entry
CFSAN002069_20200 CDS       T02735                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
senh  Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:senh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFSAN002069_20200
   00290 Valine, leucine and isoleucine biosynthesis
    CFSAN002069_20200
   00220 Arginine biosynthesis
    CFSAN002069_20200
Enzymes [BR:senh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CFSAN002069_20200
    2.6.1.66  valine---pyruvate transaminase
     CFSAN002069_20200
Amino acid related enzymes [BR:senh01007]
 Aminotransferase (transaminase)
  Class I
   CFSAN002069_20200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2919444..2920658
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacattcgtggcccc
gttctgaaagaagcgaaacgccttgaggaagaaggtaataaagttcttaaactgaatatc
ggcaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatttgccgacggcgcaaggatattgcgactcgaaagggctttattctgcccgtaaagcg
attatgcagcattatcaggcccgtggaatgcgcgatgtaaccgtggaagatatctatatc
ggtaacggcgtttccgagctgatcgttcaggcgatgcaggcgttgcttaacagtggcgat
gaaatgctggttcccgcgcccgattatccgttatggacagcggcggtatcgctctccagc
ggcaaggcggtacattatctttgcgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaatcaccccacgtacgcgtggtattgtcattattaatccaaacaaccct
actggcgccgtctattctaaagaattgttgatggaaattgtcaacattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagattctctatgacgatgccgagcat
cactctatcgccgcactggcgcctgatctgctgaccatcacctttaatgggttgtctaaa
acctatcgcgtcgccggcttccgccagggctggatggtgctgaacgggccgaaaaaacat
gcgaaaggctatattgaagggctggagatgttagcctcaatgcgcctgtgcgccaacgtc
ccggcgcaacatgctattcagaccgcgctcggcggctatcaaagcattagtgaatttatt
ctgccgggcggtcgactgtatgaacagcgtaaccgcgcctgggagttgattaacgatatt
cccggcgtttcctgcgtaaaaccgcgcggcgcgttgtacatgttccccaggatcgacgct
aaacgttttaatattcacgacgaccagaagatggtgctggacttcctgctacaggaaaag
gtgctgctggtgcaaggtaccgcctttaactggccgtggccggatcacttccgcattgtg
acgctaccgcgtgaagatgacctggagatggccatcaaccgttttgggcgtttcctctca
ggttaccatcaataa

DBGET integrated database retrieval system