KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_46750Help
Entry
SN31241_46750     CDS       T02779                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Brite
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SN31241_46750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4737119..4737751)
Genome map
AA seq 210 aa AA seqDB search
MEMIMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEE
LITKLDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAE
FEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYL
KFQNRRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagatgattatgagttatacactgccatccctgccgtacgcttatgatgcactggaa
ccgcacttcgataagcagacgatggagattcaccacaccaaacaccatcaaacctatgtc
aacaacgctaacgcggcgctggaaaacctgcctgagtttgctgacctgccggttgaagaa
ctgattactaaactggaccaggtgccagcggacaaaaaaaccgtgctgcgtaacaacgcc
ggcggccacgctaaccacagcctgttctggaaagggctgaaaaaaggcaccactctgcag
ggcgatctgaaagcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaa
ttcgaaaaagcagcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggc
gataaactggctgtggtttctaccgctaaccaggattccccgctgatgggtgaagccatt
tccggcgcttccggcttcccgatcctgggtctggacgtgtgggaacacgcttactatctg
aaattccagaaccgccgcccggactacatcaaagagttctggaacgtggtgaactgggac
gaagcagcagcgcgtttcgccgctaaaaaataa

DBGET integrated database retrieval system