KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_20780Help
Entry
AU37_20780        CDS       T03732                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno00473  D-Alanine metabolism
seno01100  Metabolic pathways
seno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:seno00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AU37_20780 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AU37_20780 (alr)
Enzymes [BR:seno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AU37_20780 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:seno01011]
 Precursor biosynthesis
  Racemase
   AU37_20780 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHP76300
LinkDB All DBs
Position
4309542..4310621
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFNA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagcctatcctgctgctggagggt
tttttcgacgccgccgatctgccgaccatttccgcgcaatgtctgcatactgccgtacat
aatcaagagcagcttgccgccctggaggcggtggagctggcggagccggtaacggtctgg
atgaaactggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaggcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttaatgcc
ttctgtcagggtaaacccggtcagcgctctattgccgcgtctggcggtatcctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcatcattttgtatggcgtatcgccgctg
gagcacaaaccctgggggccggattttggttttcagccggtgatgtccttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggctacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggcgatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtactggtcaatggtcgtgaagttccgattgtcgggcgg
gtggcgatggatatgatttgcgtagatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggtgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system