KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4878Help
Entry
STM14_4878        CDS       T01714                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STM14_4878 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4280123..4280743
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFASLPVEELITK
LDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacaccaaacaccatcaaacctatgtcaacaacgctaac
gcggcgctggaaaacctgcctgagtttgccagcctgccggttgaagaactgattactaaa
ctggaccaggtgccagcggacaaaaaaactgtgctgcgtaacaacgcgggcggccatgct
aaccacagcctgttctggaaagggctgaaaaaaggcaccactctgcagggcgatctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaattcgaaaaagca
gcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaaactggct
gtggtttctaccgcaaaccaggattccccgctgatgggtgaagccatttccggcgcttcc
ggcttcccgatcctgggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system